Property Summary

Ligand Count 73
NCBI Gene PubMed Count 25
PubMed Score 58.39
PubTator Score 31.03

Knowledge Summary

Patent (11,503)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Experimental 108 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 4.4e-10
psoriasis 6694 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 3.028 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.700 4.4e-10
psoriasis 1.100 1.4e-03

Protein-protein Interaction (2)

Gene RIF (10)

AA Sequence

MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLVVLENLLVLAA      1 - 70
ITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFLREGLLFTALAASTFSLLFTA     71 - 140
GERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLPLLGWNCLCAFDRCSSLLPLYSKRYILFCLV    141 - 210
IFAGVLATIMGLYGAIFRLVQASGQKAPRPAARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNL    211 - 280
WAQEYLRGMDWILALAVLNSAVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGAST    281 - 350
TDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSI                                        351 - 384
//

Text Mined References (26)

PMID Year Title