Property Summary

NCBI Gene PubMed Count 159
PubMed Score 474.36
PubTator Score 289.22

Knowledge Summary

Patent (42,469)

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.3e-03
breast carcinoma -1.600 5.3e-05
cutaneous lupus erythematosus 1.200 6.1e-03
fibroadenoma -1.600 2.3e-02
glioblastoma -1.200 3.1e-02
group 4 medulloblastoma -1.700 1.2e-05
interstitial cystitis 1.400 1.9e-04
intraductal papillary-mucinous neoplasm ... -1.100 4.7e-02
invasive ductal carcinoma -1.300 3.9e-03
lung adenocarcinoma -1.600 2.9e-16
lung cancer -2.300 1.5e-04
lung carcinoma -1.900 8.9e-13
malignant mesothelioma -6.000 1.1e-09
medulloblastoma, large-cell -1.400 1.6e-02
non-small cell lung cancer -1.923 2.3e-23
primary Sjogren syndrome 1.200 4.1e-03
tuberculosis -1.800 1.5e-06

 GWAS Trait (1)

Gene RIF (133)

AA Sequence

MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTI      1 - 70
WKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAI     71 - 140
ERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVF    141 - 210
TLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDV    211 - 280
GCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEF    281 - 350
SRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS                                          351 - 382
//

Text Mined References (164)

PMID Year Title