Property Summary

NCBI Gene PubMed Count 104
PubMed Score 22.98
PubTator Score 141.74

Knowledge Summary

Patent

No data available

Expression

Gene RIF (76)

AA Sequence

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD      1 - 70
FSEFIVFVAAITSACHKYFEKAGLK                                                  71 - 95
//

Text Mined References (106)

PMID Year Title