Property Summary

Ligand Count 2
NCBI Gene PubMed Count 346
PubMed Score 3193.15
PubTator Score 5346.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Asthma 385 0.0 0.7

Expression

  Differential Expression (12)

Disease log2 FC p
Down syndrome 1.500 2.5e-04
atypical teratoid / rhabdoid tumor -2.800 2.3e-03
Breast cancer -2.800 2.1e-19
breast carcinoma -1.500 9.0e-16
colon cancer -3.600 7.5e-09
ductal carcinoma in situ -3.900 6.7e-05
group 3 medulloblastoma -3.000 3.8e-05
interstitial cystitis 1.500 2.5e-02
invasive ductal carcinoma -5.200 8.6e-05
medulloblastoma, large-cell -3.900 5.2e-05
pituitary cancer -1.400 3.7e-02
psoriasis -1.300 2.5e-08

PDB (15)

Gene RIF (306)

AA Sequence

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD      1 - 70
FQEFMAFVAMVTTACHEFFEHE                                                     71 - 92
//

Text Mined References (348)

PMID Year Title