Property Summary

NCBI Gene PubMed Count 323
PubMed Score 3042.94
PubTator Score 5346.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
Down syndrome 1.500 2.5e-04
psoriasis -1.300 2.5e-08
sonic hedgehog group medulloblastoma -4.100 5.4e-08
atypical teratoid/rhabdoid tumor -3.200 1.1e-05
medulloblastoma, large-cell -3.900 5.2e-05
colon cancer -3.600 7.5e-09
interstitial cystitis 2.000 2.2e-04
non-inflammatory breast cancer -3.000 4.0e-09
breast carcinoma -1.500 9.0e-16
ductal carcinoma in situ -3.900 6.7e-05
invasive ductal carcinoma -5.200 8.6e-05
pituitary cancer -1.400 3.7e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (284)

PMID Text
27007976 There was no association found between serum and CSF S100B with radiographic vasospasm or DIND. S100B is a potential prognostic marker for aSAH outcome
26819111 Serum S100B is a useful quantitative biomarker in routine follow-up of high-risk melanoma patients.
26600537 Our results support the hypothesis that S-100beta is an important biological indicator of HIE and serum S-100beta levels can be used as a reference index to assess hypoxic-ischemic encephalopathy severity.
26421286 This study inquires into the physiological concentrations of NSE and S100B proteins in CSF, carried out on a sufficiently large group of 601 patients.
26417594 Studied circulating S100B and adiponectin in children who underwent open heart surgery. S100B showed a significant increase from hospital admission up to 24 h after procedure.
26401738 Concentrations of serum S100B protein in brain-dead organ donors are extremely high and may support the diagnosis of brain death.
26316432 long-term exposure to high blood glucose concentrations leads to an increase in total oxidant in patients with diabetic ketoacidosis ( and that the neurotransmitter changes that develop in response to this exposure lead to an increase in S100B levels
26148794 Levels of S100B below can accurately predict normal Cranial CT findings after minor head injury
26116899 HIV-1 Vpr upregulates the gene expression of S100B in human monocyte-derived dendritic cells
26040109 results suggested the use of serum S-100beta and NSE levels as indicators for brain injury
26021463 The mean serum S-100B protein level of the breath-holding spells group was 56.38 +/- 13.26 pg/mL, and of the control group, 48.53 +/- 16.77 pg/mL.
25990800 S100B serum levels are elevated in cerebral small vessel disease patients.
25925764 serum levels may be correlated with the carbon monoxide poisoning and could be biomarker for early diagnosis and treatment monitoring
25877001 A nonsynonymous polymorphism in DCDC2 (corrected P = 0.002) and a noncoding variant in S100B (corrected P = 0.016) showed a significant association with spelling performance in families of German origin.
25849778 plasma biomarkers S100-B and copeptin did not improve prediction of poor outcome following seizure
25665147 Calbindin D28k and S100B have a similar interaction site with the lithium-inhibitable enzyme inositol monophosphatase-1: a new drug target site
25518864 The association was studied of intracranial pressure (ICP) and cerebral perfusion pressure (CPP) on S-100B and neuron-specific enolase (NSE) in severe traumatic brain injury (sTBI).
25516468 results confirm S100beta as a target of the cellular autoimmune response in type 1 diabetes with the identification of new peptide epitopes targeted during the development of the disease
25329583 ). There was no statistically significant association between the primary outcome and baseline S-100B levels, baseline high-sensitivity C-reactive protein or interleukin-6 levels, or changes in high-sensitivity C-reactive protein or interleukin-6 levels.
25202915 circulating S100B blood levels in schizophrenia
25153417 S100B concentrations increase perioperatively in jugular vein blood despite limited metabolic and inflammatory response to clinically uneventful carotid endarterectomy
25120758 these results suggest a potential predictive value of S100B and its underlying mechanism in the pathological process of polytrauma
25068442 In patients with intracranial traumatic lesions, peak S100B serum levels were found in patients with cerebral edema and brain contusions.
24899616 Evaluation of preoperative and postoperative S100B levels in children with chronic adenotonsillar hypertrophy
24760429 Serum S100Beta was better for diagnosing sepsis-associated encephalopathy than neuron-specific enolase.
24668715 Fetuses of active smoker mothers had lower cord blood S100B levels compared to fetuses of non-smoker mothers.
24656601 This study demonistrated that higher levels of S100B is independently associated with presence and number of cerebral microbleeds in patients with first-ever acute lacunar stroke, particularly in those with deep cerebral microbleeds.
24629352 The study of gene expression data confirm an involvement of S100B in mood disorders in relevant brain.
24627490 Data indicate that the S100B-p90 ribosomal S6 kinase (RSK) complex was found to be Ca2+-dependent, block phosphorylation of RSK at Thr-573, and sequester RSK to the cytosol.
24625912 S100B, a marker of blood-brain-barrier permeability, as well as serum cortisol, interleukin (IL)-6 and tumor necrosis factor (TNF)-alpha concentrations, are significantly increased in soldiers during combat training compared to the rest period.
24620985 Ascending to 3700 m resulted in elevated plasma S100B levels but this was not associated with acute mountain sickness
24610883 S100B is increased among women with preeclampsia, and high levels of S100B associate with visual disturbances
24505052 The role of S100B protein, neuron-specific enolase, and glial fibrillary acidic protein in the evaluation of hypoxic brain injury in acute carbon monoxide poisoning
24504531 This study report the downregulation of S100B in the nuclear proteome of the corpus callosum from nine schizophrenia patients.
24497226 It shows decreased AGEs and increased S100B levels and caspase down-stream apoptosis in peripheral lymphocytes of bipolar disorder (BD) patients that may underlie disease etiopathogenesis.
24470708 total sleep deprivation increased morning serum levels of NSE (P = 0.002) and S-100B (P = 0.02) by approximately 20%, compared with values obtained after a night of sleep
24402969 It was suggested that S100A1 and S100B be used as markers to develop potency assays for cartilage regeneration cell therapies, and as a redifferentiation readout in monolayer cultures aiming to investigate stimuli for chondrogenic induction.
24358202 Serum S100B is neither an intermediate phenotype, nor a trait marker for psychotic illness.
24340553 The level of S100B protein concentration is helpful in determining severity of the disease and as a prognostic marker in purulent, bacterial meningoencephalitis.
24314961 Brain death is associated with higher S100B serum levels, compared with other neurocritical care patients.
24312329 Serum S100B is a prognostic marker predicting survival at the time of initiation of first-line treatment in unresectable melanoma patients
24238018 assessment of serum protein S100B may improve detection of asymptomatic acute brain injury in patients undergoing radiofrequency catheter ablation
24211222 the serum S-100B protein levels of the patients with focal epilepsy were high compared to those of the control group
24107912 rther efforts are required to better understand the patterns of response and the immunological tumor response in patients undergoing CTLA-4 blockade.
24076007 mutations in the coding region or intron/exon boundaries of the S100B gene play little or no role in the development of Parkinson disease in Chinese population.
24063890 Mechanistic insights into the S100B-FGF2 complex interface and cell-based assay studies involving mutants led us to conclude the novel role of S100B in FGF2 mediated FGFR1 receptor inactivation.
23972702 Elevated S100B levels increase the susceptibility to environmental stimuli during adolescence resulting in more variable behavioral and neural phenotypes in adulthood
23969722 The diagnostic accuracy and the prognostic power is much higher compared to the serum protein S100B.
23907232 Measurement of S100B and LDH levels during treatment with vemurafenib indicates an initial response; however, this does not seem to be sufficient in detecting tumor progression and is thus not an alternative to monitoring with imaging examinations.
23896207 The results of this study suggested that S100B-immunopositive glia is dysregulated in the brain of patients suffering from unipolar and bipolar depression.
23889347 Increased Serum S100B levels in organic solvent exposure may indicate a preventive response to neuronal damage caused by reactive oxygen species (ROS) produced through oxidative metabolic pathways of organic solvents.
23887761 S100 beta and neuron-specific enolase are promising biomarkers for diagnosing and monitoring patients with septic encephalopathy
23860667 Measurement serum S100B could be useful to detect cerebral complications in deeply sedated patients associated with ECMO but not for monitoring delirium after sedation withdrawal.
23856918 serum S100B protein levels were elevated before and throughout the first 24 h after surgery for control of bleeding; (b) a positive correlation between S100B and IL-6 serum levels
23826805 S100B dimers A1B and BB in perinatal asphyxia nonsurvivor infants were significantly higher than in controls at all monitoring time points.
23796187 S100B and neuron enolase (NSE) B are useful markers in postmortem biochemistry in cases of suspected traumatic brrain injury.
23758329 The combined use of serum S100B and apoA-I maximizes classification accuracy for mild brain traumatic brain injury, but only S100B is needed to classify abnormal head CT scan.
23757003 Data indicate that the only constantly present diagnostic marker observed was S100 protein and, in lesser extent, also nestin.
23755753 S100B dose-dependently stimulated alveolar type I-like cells, to enhance the secretion of TNF-alpha and IL-6; S100B pro-inflammatory activity might be mediated at least in part by RAGE.
23713736 Improvement in recovery from acute cerebral infarction is associated with reduced serum levels of S100B.
23710646 24 h serum S100B levels could serve as screening tools for the early detection of patients at risk for brain death after severe traumatic brain injury.
23705829 Data showed raised serum levels of S100B in schizophrenia female patients, but not male patients, compared to controls.
23701298 review of studies investigating the glial marker S100B in serum of patients with mood disorders; S100B is elevated in mood disorders; more strongly in major depressive than bipolar disorder and successful antidepressive treatment has been associated with serum S100B reduction in major depression.
23602305 CSF s100B was elevated in hip fracture patients with delirium compared to those without delirium.
23590685 S100b was inversely correlated with the Glasgow Outcome Scale at 3 months
23587577 the extent of S100B elevation has been found to be useful in predicting clinical outcome after severe traumatic brain injury. [Review]
23528506 In this small sample, S100B, measured immediately after injury in the emergency department, did not seem to predict those children with mild traumatic brain injury who will go on to develop postconcussion syndrome.
23523337 There is an important difference in serum S100B concentrations between summer and winter. It is strongly advisable to consider this summer/winter difference in serum S100B concentrations when researching this area.
23438158 REVIEW: the clinical implications of S100B changes in schizophrenia remain to be elucidated
23406753 Serum S100B and orexin A levels may be helpful in differentiating parasomnic pediatric patients with and without epilepsy.
23380091 Serum S100B protein levels were similar between children with CO poisoning and controls at 0 and 3 and 6 hours. No correlation was found between Glasgow Coma Scale scores and S100B protein levels.
23378728 In inflamed limbal tissues, expression of S100 A4,8,9 and B proteins is dramatically decreased.
23336432 Data indicate that the high side scatter (SSC(high))-stem/progenitor cells (hDSPCs) had high in vitro proliferation properties and expressed high levels of SOX2 and S100B.
23297751 S100B adds substantial information regarding patient outcome in traumatic brain injury
23292665 Pathogens, but not probiotics, significantly induced S100B protein overexpression and NO release from enteric glial cells .
23262371 S100B in LP infants is gestational age and gender dependent
23261835 there was no correlation between whole-body tumor volume and S100beta concentration for the overall group of neurofibromatosis 1 (NF1), NF2, and schwannomatosis patients.
23208248 s100b concentration is not a useful predictor of individuals at risk of more severe long-term cognitive decline
23190274 This study evaluated S100b as a prognostic biomarker in adult subjects with severe traumatic brain injury
23169921 results demonstrate a role of S100B in the pathophysiology of Parkinson's disease.
23163123 Elevated levels of serum S100B is associated with the presence and outcome of haemorrhagic shock.
23161189 Serum S100B protein level is increased in patients with OSAS and may be a useful biochemical marker in those patients.
23146618 Increased S-100B protein serum levels appear to reflect neuronal damage in the brains of children with temporal lobe epilepsy.
23141161 S100B might be a factor in the pathogenesis of early-onset preeclampsia.
23130680 S100B mRNA was detected not only in S100B lymphocytes, but also in every S100B lymphocytes, although the expression levels of S100B mRNA in S100B lymphocytes were much lower than those of S100B lymphocytes.
23053124 this study concludes that neither increased blood lactate nor serum prolactin play an exclusive role in the regulation of S100B.
23031665 the determination of S100B levels both in urine and serum acts as a sensitive and an effective biomarker for the early prediction of mortality after severe traumatic brain injury
23030834 Cord blood S100B levels of infants born through meconium-stained amniotic fluid were not different from those with clear amniotic fluid.
22982200 decreased level of S100B in CSF is related to increased symptoms of depression in the neurological patients with non-inflammatory disorders.
22935566 The results showed a close association between S100B and depressive symptoms in patients undergoing hemodialysis.
22916238 Study is the first in vivo study validating the specificity of the glial marker S100B for the human brain, and supporting the assumption that radial diffusivity represents a myelin marker.
22782342 Visceral metastases other than lung (hazard ratio (HR) 1.8), elevated S100B (HR 1.7) and elevated LDH (HR 1.6) had the highest negative impact on survival.
22766253 plasma S100B was correlated with initial stroke score, and was significantly higher in patients with poor clinical outcome
22565174 Determination of S100B concentration in jugular samples appears to be better than in arterial to predict clinical outcome after brain injury.
22359053 an increase in glutamate uptake and S100B secretion, and a decrease in glutamine synthetase, which might be linked to the altered glutamatergic communication in diabetes mellitus
22348227 This review summarizes the available data regarding the use of S100B as a biomarker of brain damage following birth asphyxia.
22326439 despite the observation of an increase in S100B+ NK cells in schizophrenia patients, the lack of a correlation with serum S100B concentrations suggests that these cells are probably not a major source of S100B in the blood of schizophrenia patients
22322856 Patients with the apolipoprotein (APO)epsilon4 allele may be more predisposed to brain cellular damage measured as S100B and neuron-specific enolase (NSE).
22306257 The significant elevations of HMGB1 and S100B in CSF, and S100B in serum are associated with the neurologically poor outcome in OHCA patients.
22286962 S100B could be involved in the development of brain metastasis in -small cell lung cancer.
22285378 Significantly higher values of serum S100B were found in CT positive than in CT negative patients with mild head injury.
22224444 The serum levels of pro-inflammatory marker S-100beta protein increased after total hip-replacement in elderly patients and may serve as predicting parameters for the occurrence of post-operative cognitive dysfunction
22177239 The IL-1alpha-positive microglias and S100beta-positive astrocytes may be of certain significance in transformation of diffuse non-neuritic plaques to diffuse neuritic plaques in Alzheimer's disease.
22114731 S100B polymorphism is associated with aspergillosis in stem cell transplant recipients.
22025532 The expression of eosinophil RAGE, soluble RAGE and RAGE ligands may be pivotal to the functions of eosinophils in various human diseases involving RAGE and S100 ligands.
22019077 for both schizophrenia patients and healthy controls two SNPs in S100B were significantly associated with prefrontal functions in the spatial domain,with the AA genotype of rs9722 and the GG genotype of rs2839357 linked to poorer performance.
22011044 Results suggest that S100B, TM4SF3, and OLFM4 overexpression may affect metastatic behavior of tumor cells in Taiwanese colorectal cancer patients.
21976236 S100B levels in patients with worst outcome after traumatic brain injury in patients with worst outcome are already significantly higher at day zero.
21932834 Peptide array experiments identify the carboxy-terminal 58 residues of the third intracellular loop of the dopamine D2 receptor as the major interacting site for S100B.
21906477 The level of S100beta protein in CSF from CH patients increases. It may be a biomarker as reflecting degree of pathogenetic and predicting outcome in the CH patients.
21861268 S100B depletion induces apoptosis of PC14/B cells.
21861214 High S-100B is associated with treatment response in stage III melanoma.
21858537 Results show that S-100B, MIA and LDH levels were significantly higher in patients with advanced melanoma than in disease-free patients or healthy controls.
21810220 Data indicate that measurements of serum S100B during regular follow-up of patients with CM are a useful tool for discovering disease progression in asymptomatic patients.
21779383 S100B and APP levels are simultaneously increased within Down syndrome neural progenitors, their secretions are synergistically enhanced in a paracrine fashion, and their overexpressions disrupt mitochondrial membrane potentials and redox states.
21738758 S100B protein, BDNF, and GDNF are present in all samples of human milk, and they may be responsible for the long term effects of breast feeding.
21725169 Treadmill exercise training decreased the expression of S100 beta in the striatum of chronic Parkinsonian mice, which can partially explain the beneficial neuroprotective role of exercise in patients with parkinson disease.
21714070 These studies have identified S100B as a potential biomarker for illness severity and therapeutic response in psychiatric patients.
21688665 concentration of IL-1beta, INF-gamma, TNF-alpha, S100beta, AMA-M2 increase, IL-10 decrease were detected in peripheral blood of 25 patients with stroke
21674567 Some neurofibromas include a subpopulation of S100B(+) /Nfn(-) cells consistent with clonal expansion of a Schwann cell progenitor that has lost function of both NF1 alleles.
21663912 Serum levels of S100B, S100A6 and S100P are associated with acute coronary syndrome, and serum levels and myocardial expression of these proteins are related to infarct size.
21640093 Increased serum S100B levels were associated with the severity of cardiac dysfunction, renal insufficiency and an adverse prognosis in chronic heart failure patients.
21628886 nvestigation into whether S100B is involved in Parkinson's disease: creation of transgenic mice with brain-specific overexpression of human S100B creates mouse model with symptoms of Parkinson's disease (i.e., motor incoordination by Rota-rod test)
21620650 After treatment of carotid stenosis patients with an increased S-100B coefficient of variation showed diffusion-weighted magnetic resonance imaging positive for ischemic brain lesions.
21601568 This study provides useful serum S100B values from the largest cohort of healthy children aged 0-3 years old.
21587126 Serum s-100beta protein was significantly higher in off-pump coronary artery bypass graft patients with intracranial and cervical artery stenosis.
21553520 The increased level of serum S100beta and NSE may be one of the mechanisms of brain damage and memory impairment in obstructive sleep apnea-hypopnea syndrome.
21504113 A drastic rise in the level of S100beta is observed one week after coronary artery bypass grafting, a mark of a severe generalized cerebral injury that correlates with the development of cognitive dysfunction.
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21473859 S100B is pregnancy-dependent with the presence of a protein's gradient between fetal and maternal bloodstreams
21458434 S-100B can be used as a reliable and early predictor of poor physiological and cognitive neurological outcomes after cardiac arrest.
21455324 S100B protein in the gut has a role in enteroglial-sustained intestinal inflammation [review]
21447379 In various physiological and pathological conditions S100B might function as an interface to immunological processes, distinct from known cytokine- and chemokine-mediated pathways.
21423669 Upon binding to nucleic acids, S100B activated intracellular TLRs eventually resolve danger-induced inflammation via transcriptional inhibition of S100B.
21376255 Results suggest that S100B may be a potential cause of pathogenesis in Parkinson's disease.
21368691 The relationship of clinical outcome with cerebrospinal fluid neuron-specific enolase (NSE), S100B and glial fibrillary acidic protein (GFAP) levels in patients with severe traumatic brain injury was investigated
21311479 There was no correlation between the S100beta level and the type of brain lesion, its localization or volume and the fracture of cranial bones.
21303299 REVIEW: S100B protein in neurodegenerative disorders
21293918 The findings of increased ictal serum S100B and NSE levels together with increased interictal levels of S100B suggested that migraine might be associated with glial and/or neuronal damage in the brain.
21273622 Increase S-100beta level was associated with metastatic uveal melanoma.
21144594 This meta-analysis indicates a modifying effect of S100B in mood disorders in the interaction with age, with an increasing role across the lifespan.
21112154 Men homozygous for the 2757C>G or 5748C>T SNPs scored higher in self-directedness on the Temperament and Character Inventory.
21079180 Outcome prediction after traumatic brain injury can be improved with determination of serum levels of glial fibrillary acidic protein (GFAP) and S100B at the time of hospital admission.
21070816 The results of this study implicated a role for S100B gene polymorphisms in the cognitive functions of schizophrenia patients and encourage further investigation into spatial disability as an endophenotype of schizophrenia.
21070816 Observational study of gene-disease association. (HuGE Navigator)
21034449 Data show that the degree of systemic inflammation is associated with S100B concentration in acute ischaemic stroke, independent of the size of the ischaemic lesion.
20950652 Zn(2+)-Ca(2+)-loaded S100B the C-termini of helix IV adopt a distinct conformation.
20947022 Results enhance understanding of the functional outcomes of S100 protein binding to RAGE and provide insight into mechanistic models for how the receptor is activated.
20716661 Serum levels of S100B protein do not differentiate systemic lupus erythematosus patients with and those without central neurological manifestations.
20708613 S100B is a potential alternative calcium sensor for hEAG1 potassium channels.
20686797 Study of development of secondary injuries following traumatic brain injury includes measurement of release of S100B and neuron-specific enolase (NSE) into the cerebrospinal fluid and blood.
20628824 S100B overexpression is associated with relapse in colon cancer.
20614004 hs-CRP, PAI-1, and S100B levels did not differ at all time points between appropriate-for-gestational-age and intrauterine growth-restricted groups.
20604725 behavior of S100B in biological fluid during mental and physical stress
20592382 S100B and LDH are not expressed in sentinel node progression of melanoma
20591429 S100A1, S100A2, S100A4, S100A6 and S100B interacted with MDM2 (2-125).
20587415 marker for malignant melanoma, S100B, likely contributes to cancer progression by down-regulating the tumor suppressor protein, p53.
20581773 Body mass index, creatinine clearance, and age are determinants of steady-state serum S100B concentrations in renal transplant recipients.
20559426 data support the use of S100B as an adjunctive biomarker to assess suicidal risk in patients with mood disorders or schizophrenia
20509936 there were no clear signs (S100B) that the glial functions were compromised in attention deficit and hyperactivity
20473040 The genetic variant (rs2300403) of S100B was tested for association with cognitive abilities and lifetime cognitive ageing in approximately 1000 elderly Scots.
20437790 Most patients had increased serum levels of S100beta (mean .25 microg/L, median .15 microg/L) following surgery.
20398908 Observational study of gene-disease association. (HuGE Navigator)
20351179 Data show that ATAD3A is a calcium-dependent S100B target protein in oligodendrocyte progenitor cells and suggest that S100B could assist the newly synthesized ATAD3A protein in proper folding and subcellular localization.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20105309 serum levels of S100B may be a marker for brain functional condition and serum NSE levels may be a marker for morphological status in Alzheimer's disease
20093730 S100B plays a role in schizophrenia [review]
20042890 a higher percentage of S100B antigen-positive cells were observed in benign melanocytic lesions than in melanomas
20036866 Near Infrared Spectroscopy parameters and S100B protein correlation may be of help in brain function monitoring.
20036852 Neural tube defects are associated with increased serum concentration of S100B in fetuses and mothers.
19939849 Findings show that oxidative stress affects sEng and S100B protein expression from villous and amniotic tissues, and S100B protein up-regulate sEng release from endothelial cells leading to endothelial dysfunction.
19910580 interaction of RAGE and its ligand S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53 signaling.
19812958 Following brain injury, the S100B passage from the CSF to the blood was significantly impaired and higher ratios of S100B serum/CSF were correlated with better neurological function
19705461 These results provide evidence that (over)-expression of S100B acts to accelerate AD-like pathology, and suggest that inhibiting astrocytic activation by blocking S100B biosynthesis may be a promising therapeutic strategy to delay AD progression.
19674846 Physiological S100B levels in humans appear to closely reflect adipose tissue mass, which should therefore be considered as an important confounding factor in clinical studies examining the role of S100B.
19671853 Only sULBP2 is an independent predictor of prognosis, the significance of which is superior to the well-established and widely used melanoma serum marker S100B.
19654082 Adding the measurement of S-100B serum concentration to clinical decision rules for a CT scan in patients with minor head injuries could allow a 30% reduction in scans.
19636631 Elevated S-100B level is associated with recurrence in melanoma patients.
19558426 Results describe the association of S100B and nitric oxide production in ulcerative colitis.
19539717 serum S100B levels in chronic schizophrenia under antipsychotic medication may be increased
19505208 Serum S100b and BNP levels in the first 24 h after injury accurately predict neurological function at discharge after supratentorial intracerebral haemorrhage
19497163 Our findings did not suggest association of S100B gene polymorphisms in patients with MDD in China. We found there were differences in depressive episodes among different genotypes of S100B gene.
19497163 Observational study of gene-disease association. (HuGE Navigator)
19487970 Increased S100B level is found after spontaneous intracerebral hemorrhage and may contribute to the inflammatory process of ICH, in association with a poor clinical outcome.
19482672 S100A1B and S100BB are increased in urine collected from asphyxiated newborns who will develop hypoxic-ischemic encephalopathy (HIE) since first urination, and their measurement may be useful to early predict HIE.
19468240 findings provide evidence of an association between S100B levels and memory processes in patients with recurrent depression and further suggest a neuroprotective role of moderately increased S100B serum levels in the course of affective disorders
19330775 results suggest an important role of S100B SNPs on S100B serum concentrations and S100B mRNA expression. It hereby links recent evidence for both, the impact of S100B gene variation on various neurological or psychiatric disorders
19330775 Observational study of gene-disease association. (HuGE Navigator)
19307814 The timing, intensity, and duration of serum NSE and S-100B biomarker concentration patterns are associated with neurologic and survival outcomes following pediatric cardiac arrest.
19297317 S100B bound the tetramer and also disrupted the dimer by binding monomeric p53
19229202 Results of this meta-analysis indicate S100B is involved in the pathogenesis of both schizophrenia and mood disorders; further, it dissociates major depressive and bipolar I disorder [review].
19221847 There are no differences in S100B and NSE levels between patients with ischemic stroke or intracerebral hemorrhage.
19220958 Levels of plasma S-100 beta and NSE cannot predict encephalopathy after orthotopic liver transplantation.
19216510 Studies show that monomeric S100B and S100A11 proteins are alpha-helical and retain a significant amount of tertiary structure.
19205880 These results confirm previous S100beta evaluations in human serum and cerebrospinal fluid reporting the protein's function as a biomarker for brain damage
19202335 Criteria for a clinically informative serum biomarker in acute ischaemic stroke: a review of S100B.
19183802 Increased S100B protein urine levels in term newborns suffering perinatal asphyxia seem to suggest a higher risk of neonatal death for these infants.
19147496 S100B interacts with Src kinase, thereby stimulating the PI3K/Akt and PI3K/RhoA pathways.
19103440 Our results provide support for a reduction of S100B levels during reconvalescence from acute paranoid schizophrenia that is regulated by its scavenger advanced glycosylation end product-specific receptor
19086053 Observational study of gene-disease association. (HuGE Navigator)
19042077 A strong positive correlation exists between amniotic fluid S100B and erythropoietin concentrations in pregnancies at high risk for chronic fetal hypoxia.
19011512 Circulating S100A1B and S100BB are potential biomarkers in patients with malignant melanoma. S100BB should be considered as the preferred biomarker, showing potential in predicting both relapse and survival, in contrast to both S100 and S100A1B.
18982242 These findings confirmed an increase in serum S100B levels in major depressive patients and presence of a sexual dimorphism. Moreover, numbers of depressive episodes in depression seemed to have an additional increasing effect on S100B levels.
18948614 A diagnostic tool incorporating the values of matrix metalloproteinase 9, brain natriuretic factor, d-dimer, and S-100beta into a composite score was sensitive for acute cerebral ischemia.
18939940 investigated the association of the rs9722 C > T polymorphism of the S100B gene and susceptibility to major depressive disorder by comparing 152 major depressive patients with 150 healthy individuals in a Chinese population
18939940 Observational study of gene-disease association. (HuGE Navigator)
18854308 HNRNP K and microRNA-16 have roles in cyclooxygenase-2 RNA stability induced by S100b, a ligand of the receptor for advanced glycation end products
18805362 Data show that total serum bilirubin and mean serum S100B levels of infants who manifest auditory neuropathy, neurologic abnormalities, or EEG abnormalities are significantly higher than in infants without these abnormalities.
18783450 During migraine attacks elevated s100b levels could be observed
18706914 Results identify of a dimeric intermediate in the unfolding pathway for the calcium-binding protein S100B.
18614943 S-100beta concentrations do not necessarily increase in response to exercise-heat strain, and no effect of heat acclimation on S-100beta could be observed despite other quantifiable physiological adaptations.
18596106 HIV-1 NEF expression prevents AP-2-mediated internalization of the MHC Class II-associated invariant chain.
18587628 Only the first IQ motif of IQGAP1 interacts with MYL6B. The first and second IQ motifs of IQGAP1 interact with S100B in the presence of calcium ions.
18552513 Findings demonstrate that greater S100beta levels are associated with poorer cognitive function in healthy older adults.
18494933 S100B inducs tau protein hyperphosphorylation via Dickopff-1 up-regulation and disrupts the Wnt pathway in neural stem cells.
18454941 Ooor dualistic views that consider S100B elevation as "bad" or "good" simplify clinical practice and delay our comprehension of the role of this protein, both in physiological conditions and in brain disorders. [REVIEW]
18451356 S100B has a role in exacerbating brain damage and periinfarct reactive gliosis (astrocytosis and microgliosis) during the subacute phase of middle cerebral artery occlusion
18445708 A novel interaction is identified between S100B and the dopamine D2 receptor; binding of S100B to the dopamine D2 receptor may enhance receptor signaling.
18385926 We investigated the influence of chronic fasting and subsequent weight gain on serum levels of S100B in patients with anorexia nervosa. We found that nutritional status was an important factor influencing serum levels of S100B.
18384084 The structure of human apo-S100B at 10 degrees C was determined to examine whether temperature might be responsible for structural differences.
18337650 evaluation of S100B in bone marrow (BM) plasma from malignant melanoma patients; median S100B level in BM plasma was 9.0 microg/l, an unexpectedly high value compared with the median S100B level in blood; S100B levels in BM seems to be sex dependent
18193148 Both S100A1B and S100BB were related to outcome after severe traumatic brain injury. Even though this study is small, it seems unlikely that separate analyses of the dimers are of any advantage compared with measuring S100B alone.
18181515 The low levels of S100b detected using the present assay, despite its high sensitivity and despite the routine use of cardiotomy suction, suggest that the assay may have higher specificity for cerebral S100b than previously used assays.
18173564 Serum S100b (astrocyte-specific protein) is a useful marker of hepatic encephalopathy in patients with fulminant hepatitis.
18039581 The approach allows the use of small animal PET and provides novel probes to delineate functional expression of RAGE under normal and pathophysiological conditions in rodent models of disease.
17984939 The difference between the evening and morning S100B levels correlated negatively with apnea/hyponea index and oxygen desaturation index and positively with basal saturation and average minimal oxygen saturation.
17984926 A significant increase of S-100B protein blood plasma concentrations was seen in patients with severe stroke; S-100 protein blood plasma concentration assessed on the 1st day after the stroke has highest diagnostic utility.
17984171 upregulated expression of chromosome 21 genes such as S100B and amyloid precursor protein activated the stress response kinase pathways, and furthermore, could be linked to upregulation of the water channel aquaporin 4 in Down syndrome neural progenitors
17955279 serum and CSF S100B levels were raised in neruopsychiatric systemic lupus erythematosus, especially in patients with organic brain syndrome, seizures, cerebral vascular accident, and psychosis.
17726019 S100B modulates cell survival by interacting with distinct RAGE immunoglobulin domains.
17719207 serum level increased in psoriasis
17705023 Serum S100B levels cannot serve as peripheral marker in the evaluation of brain disease in X-ALD and GD.
17678654 Enteric glial-derived S100B is increased in the duodenum of patients with celiac disease and plays a role in nitric oxide production.
17661202 An antigen in melanoma, elevated amd present in Stage III melanoma patients undergoing adjuvant vaccine immunotherapy. .
17660747 Structural and the binding data suggest that tetrameric S100B triggers RAGE activation by receptor dimerisation.
17624933 An elevated concentration of amniotic fluid S100B may reflect intra-amniotic infection/inflammation and not necessarily fetal neurologic damage.
17579612 Observational study of gene-disease association. (HuGE Navigator)
17579612 Genetic variant in S100beta increases the risk of low cognitive performance and dementia, possibly by favouring a splicing event increasing S100beta2 isoform expression in the brain.
17536784 Amide exchange shows calcium-induced conformational changes are transmitted to the dimer interface of S100B.
17525977 Observational study of gene-disease association. (HuGE Navigator)
17525977 Genetic variants within S100B are associated with bipolar affective disorder with psychosis
17408991 No significant release of S100beta protein in CSF during stenting of the thoracic aorta in this subgroup of patients at high risk for spinal cord ischemia.
17396138 Report concludes that S100A1 and S100B are transcriptional targets of the SOX trio and mediate its inhibition of terminal differentiation of chondrocytes.
17348038 Review examines S100B's potential role as a neurologic screening tool, or biomarker of CNS injury, analogous to the role of CRP as a marker of systemic inflammation.
17264538 S-100B and MIA concentrations were significantly higher in patients with uveal melanoma metastases
17199889 S100B is localized in many neural cell-types and is less astrocyte-specific than GFAP.
17091777 S100B protein levels are affected differently in alcohol-dependent individuals with either mild or high alcohol consumption during the period of up to one year before assessment.
17043297 finding of increased levels of S100B in patients with schizophrenia without an indication for significant glial (GFAP, MBP) or neuronal (NSE) damage may be interpreted as indirect evidence for increased active secretion of S100B during acute psychosis
17023485 Amniotic fluid S100B protein concentration of the pre-eclampsia & normotensive IUGR cases was significantly higher than that of the control. Amnion could be a source responsible for the increased concentration of S100B in amniotic fluid.
17020600 Serum S100beta levels may serve as a potentially useful early marker of postcraniotomy brain damage in patients undergoing elective meningioma resection.
17010455 Phosphorylation of specific serine and/or threonine residues reduces the affinity of the S100B-p53 interaction.
17008613 Increased plasma S100B level is found following acute spontaneous intracerebral hemorrhage, in association with a worse early and late evolution, and closely related to initial hematoma volume.
16931519 IP-10 mRNA is stabilized by RNA-binding proteins in monocytes treated with S100b
16511125 X-ray diffraction studies on human Ca2+-binding protein S100B
16340181 determination of urinary S-100B concentrations might be helpful in term infants with severe asphyxia, while high urinary S-100B concentrations in preterm infants are to be attributed to immaturity
16143320 Study indicates that the serum concentration of S100B in patients with neural tube defects is similar to that of normal individuals.
15820773 The higher levels of S100B in Down Syndrome patients may reflect a general and persistent increase in the extracellular space and may be associated with neurodegenerative lesions observed in these patients.
15781852 S100B regulates the oligomerization of p53 tumor suppressor by binding to its tetramerization domain.
15708543 The present study offers data consistent with the putative neurotrophic role of S100B and suggests the usefulness of saliva in the clinical monitoring of S100B levels.
15670788 Observational study of gene-disease association. (HuGE Navigator)
15670788 Our results suggest that S100B could be a susceptible gene for schizophrenia and provide indirect evidence for the GGF/SD hypothesis.
15306236 S100B overexpression in young (70 days) and aged (200 days) adult transgenic mice leads to alterations in cytoskeletal markers with aging.
15257081 S100B and IL-1beta in the cerebrospinal fluid may have a role in the progression of traumatic brain injury
15236402 results support the idea that elevated levels of S100B in the brain are associated with increased vulnerability to neurological injury
15178678 when p53 protein levels increase, it contributes to its own demise by up-regulating the transcription of S100B protein as part of a negative feedback loop
14997170 S100B in schizophrenic patients either promotes apoptotic mechanisms by itself or is released from astrocytes as part of an attempt to repair a degenerative or destructive process
14967825 results indicate that human S100B expressed in E Coli interacts with the tubulin homologue FtsZ in vivo, modulating its activity in bacterial cell division.
14699277 Protein S-100b might be a promising serum marker with prognostic significance in the event of spinal cord compression resulting from epidural empyema.
14675567 positively correlated with Phe blood level in phenylketonuria patients; blood estimation could be a useful peripheral marker of CNS lesions in patients with demyelinated disease such as PKU
14642437 S100 beta showed a significant decrease in CSF over the disease course (P=0.024).
14530578 Review summarizes current knowledge about S-100B serum measurements in severe head injury and concludes that S-100B belongs to a new generation of molecular serum markers of brain damage.
12927678 Results in high-risk pregnancies demonstrated that S100B concentration increased in amniotic fluid and in cord blood of fetuses with brain damage [review]
12645009 increased levels have been detected in brain trauma and ischemia, and in neurodegenerative, inflammatory and psychiatric diseases, probably due to release from damaged astrocytes
12630517 S 100 B may be a reliable marker of brain damage in TBI without multiple trauma 24 h after trauma and thereafter
12569284 Elevated serum S100B level was associated with metastatic malignant melanoma
12527118 presence in human milk - may contribute to biochemical communication between mother and child
12505619 Cerebrospinal fluid S100B correlates with brain atrophy in Alzheimer's disease, suggesting that S100B is of pathological relevance for degeneration of the central nervous system in Alzheimer's disease.
12490005 Serum S100B is increased in almost half of children after mild, moderate, and severe inflicted and noninflicted closed head injury; the increase is transient, lasting less than 12 h after injury, except in children with severe injury.
12480931 A new target is revealed by the solution structure of a peptide fragment.
12377780 the major cytoplasmic S100B target protein in different glial cell lines in the presence of Zn(2+) and Ca(2+) is IQGAP1
12351263 preoperative S100B concentrations correlate inversely with the size of the ascending aorta in hypoplastic left heart syndrome and may serve as a marker for preexisting brain injury and mortality
11969402 A study of S100B identifying key regions required for the interaction with S100B-binding epitope TRTK-12 shows that the S100B linker region contributes about 50% to binding while the C-terminus contributes the remaining 50% of the binding energy.
11888280 role of N-terminal helix I for dimerization and stability
11809917 This study provides evidence that circulating S100beta protein is increased in IUGR fetuses and correlates with cerebral hemodynamics, suggesting that it may represent an index of cerebral cell damage in the perinatal period.

AA Sequence

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD      1 - 70
FQEFMAFVAMVTTACHEFFEHE                                                     71 - 92
//

Text Mined References (325)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27007976 2016 Association between S100B Levels and Long-Term Outcome after Aneurysmal Subarachnoid Hemorrhage: Systematic Review and Pooled Analysis.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26819111 2016 Biomarker value and pitfalls of serum S100B in the follow-up of high-risk melanoma patients.
26600537 2015 Serum levels of S-100? correlate with the clinical status and severity of hypoxic-ischemic encephalopathy in neonates.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26421286 2015 Biomarkers of Brain Damage: S100B and NSE Concentrations in Cerebrospinal Fluid--A Normative Study.
26417594 2015 Circulating S100B and Adiponectin in Children Who Underwent Open Heart Surgery and Cardiopulmonary Bypass.
26401738 2015 Serum S100B protein concentration in brain-dead organ donors: a pilot study.
26316432 2015 Evaluation of Pre-Treatment and Post-Treatment S100B, Oxidant and Antioxidant Capacity in Children with Diabetic Ketoacidosis.
26148794 2015 Evaluation of S100B in the diagnosis of suspected intracranial hemorrhage after minor head injury in patients who are receiving platelet aggregation inhibitors and in patients 65 years of age and older.
26040109 2015 Serum neuron-specific enolase and S-100? levels as prognostic follow-up markers for oxygen administered carbon monoxide intoxication cases.
26021463 2015 Assessment of both serum S-100B protein and neuropeptide-Y levels in childhood breath-holding spells.
25990800 2015 S100B and ADMA in cerebral small vessel disease and cognitive dysfunction.
25925764 2015 Serum S100B level may be correlated with carbon monoxide poisoning.
25877001 2015 Polymorphisms in DCDC2 and S100B associate with developmental dyslexia.
25849778 2015 Predictive value of S100-B and copeptin for outcomes following seizure: the BISTRO International Cohort Study.
25665147 2015 Calbindin D28k and S100B have a similar interaction site with the lithium-inhibitable enzyme inositol monophosphatase-1: a new drug target site.
25518864 2015 Association of ICP, CPP, CT findings and S-100B and NSE in severe traumatic head injury. Prognostic value of the biomarkers.
25516468 2015 Characterization of the autoimmune response against the nerve tissue S100? in patients with type 1 diabetes.
25416956 2014 A proteome-scale map of the human interactome network.
25329583 2014 Blood levels of S-100 calcium-binding protein B, high-sensitivity C-reactive protein, and interleukin-6 for changes in depressive symptom severity after coronary artery bypass grafting: prospective cohort nested within a randomized, controlled trial.
25202915 2014 Systematic review and meta-analysis of circulating S100B blood levels in schizophrenia.
25153417 2015 S100B concentrations increase perioperatively in jugular vein blood despite limited metabolic and inflammatory response to clinically uneventful carotid endarterectomy.
25120758 2014 S100B ranks as a new marker of multiple traumas in patients and may accelerate its development by regulating endothelial cell dysfunction.
25068442 2015 Analysis of S100 calcium binding protein B serum levels in different types of traumatic intracranial lesions.
24899616 2014 Evaluation of preoperative and postoperative S-100B levels in children with chronic adenotonsillar hypertrophy: preliminary results.
24760429 2014 Serum S100? is a better biomarker than neuron-specific enolase for sepsis-associated encephalopathy and determining its prognosis: a prospective and observational study.
24668715 2014 Umbilical CORD S100B levels in active and passive smoker women.
24656601 2014 Correlation between cerebral microbleeds and S100B/RAGE in acute lacunar stroke patients.
24629352 2014 Further evidence for a role of S100B in mood disorders: a human gene expression mega-analysis.
24627490 2014 Complex formation between S100B protein and the p90 ribosomal S6 kinase (RSK) in malignant melanoma is calcium-dependent and inhibits extracellular signal-regulated kinase (ERK)-mediated phosphorylation of RSK.
24625912 2014 Combat-training stress in soldiers increases S100B, a marker of increased blood-brain-barrier permeability, and induces immune activation.
24620985 2014 Elevated plasma S100B levels in high altitude hypobaric hypoxia do not correlate with acute mountain sickness.
24610883 2014 Plasma levels of S100B in preeclampsia and association with possible central nervous system effects.
24505052 2014 The role of S100B protein, neuron-specific enolase, and glial fibrillary acidic protein in the evaluation of hypoxic brain injury in acute carbon monoxide poisoning.
24504531 2014 S100B is downregulated in the nuclear proteome of schizophrenia corpus callosum.
24497226 2014 Peripheral blood lymphocytes from patients with bipolar disorder demonstrate apoptosis and differential regulation of advanced glycation end products and S100B.
24470708 2014 Acute sleep deprivation increases serum levels of neuron-specific enolase (NSE) and S100 calcium binding protein B (S-100B) in healthy young men.
24402969 2014 S100A1 and S100B expression patterns identify differentiation status of human articular chondrocytes.
24358202 2013 Replicated evidence of absence of association between serum S100B and (risk of) psychotic disorder.
24340553 2013 Evaluation of cerebrospinal fluid S100B protein concentration in patients with purulent, bacterial meningitis - own observations.
24314961 2013 Serologic behavior of S100B protein in patients who are brain dead: preliminary results.
24312329 2013 Serum S100B, lactate dehydrogenase and brain metastasis are prognostic factors in patients with distant melanoma metastasis and systemic therapy.
24238018 2014 A novel biomarker-based approach for the detection of asymptomatic brain injury during catheter ablation of atrial fibrillation.
24211222 2014 Interictal serum S-100B protein levels in intractable epilepsy: a case-control study.
24107912 2013 Serum S100B levels correlate with clinical benefit in a metastatic melanoma patient treated by CTLA-4 blockade: a case report.
24076007 2013 Genetic analysis of the S100B gene in Chinese patients with Parkinson disease.
24063890 2013 Structural insights into the interaction of human S100B and basic fibroblast growth factor (FGF2): Effects on FGFR1 receptor signaling.
23972702 2013 S100B overexpression increases behavioral and neural plasticity in response to the social environment during adolescence.
23969722 2013 18FDG-PET to assess recurrence and long term survival in patients with malignant melanoma.
23907232 2013 S100B and lactate dehydrogenase as response and progression markers during treatment with vemurafenib in patients with advanced melanoma.
23896207 2013 S100B-immunopositive astrocytes and oligodendrocytes in the hippocampus are differentially afflicted in unipolar and bipolar depression: a postmortem study.
23889347 Assessment of serum S100B and neuron specific enolase levels to evaluate the neurotox?c effects of organ?c solvent exposure.
23887761 2013 Biomarkers in septic encephalopathy: a systematic review of clinical studies.
23860667 2014 Serum S100B protein could help to detect cerebral complications associated with extracorporeal membrane oxygenation (ECMO).
23856918 2013 Serum S100B protein is increased and correlates with interleukin 6, hypoperfusion indices, and outcome in patients admitted for surgical control of hemorrhage.
23826805 2013 Urine S100 BB and A1B dimers are valuable predictors of adverse outcome in full-term asphyxiated infants.
23796187 2013 S100B and NSE as useful postmortem biochemical markers of traumatic brain injury in autopsy cases.
23758329 2013 Classification accuracy of serum Apo A-I and S100B for the diagnosis of mild traumatic brain injury and prediction of abnormal initial head computed tomography scan.
23757003 2013 Cultivation-dependent plasticity of melanoma phenotype.
23755753 S100B induces the release of pro-inflammatory cytokines in alveolar type I-like cells.
23713736 2013 Electroacupuncture reduces hemiplegia following acute middle cerebral artery infarction with alteration of serum NSE, S-100B and endothelin.
23710646 2013 S100B protein may detect brain death development after severe traumatic brain injury.
23705829 2013 Levels of S100B are raised in female patients with schizophrenia.
23701298 2013 Serum S100B represents a new biomarker for mood disorders.
23602305 2013 Delirium and cerebrospinal fluid S100B in hip fracture patients: a preliminary study.
23590685 2013 The prognostic significance of the serum biomarker heart-fatty acidic binding protein in comparison with s100b in severe traumatic brain injury.
23587577 [Interest of S100B protein blood level determination in severe or moderate head injury].
23528506 2013 Inability of S100B to predict postconcussion syndrome in children who present to the emergency department with mild traumatic brain injury: a brief report.
23523337 2013 Summer/winter changes in serum S100B protein concentration as a source of research variance.
23438158 2013 S100B and schizophrenia.
23406753 2012 Level of S100B protein, neuron specific enolase, orexin A, adiponectin and insulin-like growth factor in serum of pediatric patients suffering from sleep disorders with or without epilepsy.
23380091 2013 Neuron-specific enolase and S100B protein in children with carbon monoxide poisoning: children are not just small adults.
23378728 2013 S100 A and B expression in normal and inflamed human limbus.
23336432 2013 Enrichment and characterization of human dermal stem/progenitor cells by intracellular granularity.
23297751 2013 S100B is an important outcome predictor in traumatic brain injury.
23292665 2014 Enteroglial-derived S100B protein integrates bacteria-induced Toll-like receptor signalling in human enteric glial cells.
23262371 2013 S100B urine concentrations in late preterm infants are gestational age and gender dependent.
23261835 2013 Plasma S100? is not a useful biomarker for tumor burden in neurofibromatosis.
23208248 2012 Analysis of neuron-specific enolase and S100B as biomarkers of cognitive decline following surgery in older people.
23190274 2013 S100b as a prognostic biomarker in outcome prediction for patients with severe traumatic brain injury.
23169921 2012 S100B is increased in Parkinson's disease and ablation protects against MPTP-induced toxicity through the RAGE and TNF-? pathway.
23163123 2012 Elevated levels of serum S100B is associated with the presence and outcome of haemorrhagic shock.
23161189 Serum S100B protein: a useful marker in obstructive sleep apnea syndrome.
23146618 2013 Elevated serum S-100B levels in children with temporal lobe epilepsy.
23141161 2012 [Relationship of S100B protein expression and the pathogenesis of early-onset and late-onset preeclampsia].
23130680 2013 Morphologic, flow cytometric, functional, and molecular analyses of S100B positive lymphocytes, unique cytotoxic lymphocytes containing S100B protein.
23053124 2013 The impact of increased blood lactate on serum S100B and prolactin concentrations in male adult athletes.
23031665 2012 Role of S100B protein in urine and serum as an early predictor of mortality after severe traumatic brain injury in adults.
23030834 2013 Cord blood S100B levels in low-risk term pregnancies with meconium-stained amniotic fluid.
22982200 2012 Cerebrospinal fluid S100B levels reflect symptoms of depression in patients with non-inflammatory neurological disorders.
22935566 2012 Serum S100B protein is associated with depressive symptoms in patients with end-stage renal disease.
22916238 2012 Validating serum S100B and neuron-specific enolase as biomarkers for the human brain - a combined serum, gene expression and MRI study.
22782342 2012 Serum markers lactate dehydrogenase and S100B predict independently disease outcome in melanoma patients with distant metastasis.
22766253 2013 Plasma heart-type fatty acid binding protein level in acute ischemic stroke: comparative analysis with plasma S100B level for diagnosis of stroke and prediction of long-term clinical outcome.
22565174 [Jugular venous and arterial concentrations of serum S100B protein in patients with severe head injury].
22399290 2012 S100 proteins modulate protein phosphatase 5 function: a link between CA2+ signal transduction and protein dephosphorylation.
22359053 2012 High-glucose and S100B stimulate glutamate uptake in C6 glioma cells.
22348227 2012 S100B - a potential biomarker for early detection of neonatal brain damage following asphyxia.
22326439 2012 Increased S100B+ NK cell counts in acutely ill schizophrenia patients are correlated with the free cortisol index, but not with S100B serum levels.
22322856 2012 The release of S-100B and NSE in severe traumatic head injury is associated with APOE ?4.
22306257 2012 Prediction of the neurological outcome with intrathecal high mobility group box 1 and S100B in cardiac arrest victims: a pilot study.
22286962 2012 S100B protein as a possible participant in the brain metastasis of NSCLC.
22286170 2012 The combination of a genome-wide association study of lymphocyte count and analysis of gene expression data reveals novel asthma candidate genes.
22285378 2012 Serum levels of protein S100B predict intracranial lesions in mild head injury.
22224444 2012 Perioperative inflammatory response and protein S-100? concentrations - relationship with post-operative cognitive dysfunction in elderly patients.
22177239 2011 [Expression of cytokine IL-1? and S100? in different types of plaques in Alzheimer's disease].
22114731 2011 Genetically-determined hyperfunction of the S100B/RAGE axis is a risk factor for aspergillosis in stem cell transplant recipients.
22025532 2011 Human eosinophils express RAGE, produce RAGE ligands, exhibit PKC-delta phosphorylation and enhanced viability in response to the RAGE ligand, S100B.
22019077 2012 S100B gene polymorphisms predict prefrontal spatial function in both schizophrenia patients and healthy individuals.
22011044 2012 Overexpression of S100B, TM4SF4, and OLFM4 genes is correlated with liver metastasis in Taiwanese colorectal cancer patients.
21976236 2012 The usefulness of S100B, NSE, GFAP, NF-H, secretagogin and Hsp70 as a predictive biomarker of outcome in children with traumatic brain injury.
21932834 2011 Identification of calcium-independent and calcium-enhanced binding between S100B and the dopamine D2 receptor.
21906477 2011 [The clinical significance of S100? protein in cerebrospinal fluid and serum from the patients with cerebral hemorrhage].
21861268 2011 S100B promotes the proliferation, migration and invasion of specific brain metastatic lung adenocarcinoma cell line.
21861214 2012 Use of S-100B to evaluate therapy effects during bevacizumab induction treatment in AJCC stage III melanoma.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21810220 2011 Role of serum S100B and PET-CT in follow-up of patients with cutaneous melanoma.
21779383 2011 S100B and APP promote a gliocentric shift and impaired neurogenesis in Down syndrome neural progenitors.
21738758 2011 S100B protein, brain-derived neurotrophic factor, and glial cell line-derived neurotrophic factor in human milk.
21725169 2011 Effect of endurance exercise training on the expression of GFAP, S100B, and NSE in the striatum of chronic/progressive mouse model of Parkinson's disease.
21714070 2011 Functional assessment of a promoter polymorphism in S100B, a putative risk variant for bipolar disorder.
21688665 [IL-1beta, IL-10, INF-gamma, TNF-alpha, S100beta, AMA-M2 and cell immune response in stroke].
21674567 2011 S100B and neurofibromin immunostaining and X-inactivation patterns of laser-microdissected cells indicate a multicellular origin of some NF1-associated neurofibromas.
21663912 2011 Association of increased S100B, S100A6 and S100P in serum levels with acute coronary syndrome and also with the severity of myocardial infarction in cardiac tissue of rat models with ischemia-reperfusion injury.
21640093 2011 Increased serum levels of S100B are related to the severity of cardiac dysfunction, renal insufficiency and major cardiac events in patients with chronic heart failure.
21628886 2011 Metabonomics study of brain-specific human S100B transgenic mice by using high-performance liquid chromatography coupled with quadrupole time of flight mass spectrometry.
21620650 2011 Protein S-100B as biochemical marker of brain ischemic damage after treatment of carotid stenosis.
21601568 2011 Reference ranges for serum S100B protein during the first three years of life.
21587126 2011 Release of serum S-100? protein and neuron-specific enolase after off-pump coronary artery bypass grafting with and without intracranial and cervical artery stenosis.
21553520 2011 [The changes of memory and their correlations to S100beta protein as well as neuron-specific enolase in patients with obstructive sleep apnea-hypopnea syndrome].
21516116 2011 Next-generation sequencing to generate interactome datasets.
21504113 2010 Coronary artery bypass surgery provokes Alzheimer's disease-like changes in the cerebrospinal fluid.
21487066 2011 Plasma markers for identifying patients with metastatic melanoma.
21473859 2011 S100B protein maternal and fetal bloodstreams gradient in healthy and small for gestational age pregnancies.
21458434 2011 The significance of protein S-100B testing in cardiac arrest patients.
21455324 2011 S100B protein in the gut: the evidence for enteroglial-sustained intestinal inflammation.
21447379 2011 Human CD8(+) T cells and NK cells express and secrete S100B upon stimulation.
21423669 2011 The danger signal S100B integrates pathogen- and danger-sensing pathways to restrain inflammation.
21376255 2011 S100B transgenic mice develop features of Parkinson's disease.
21368691 2011 Neuron-specific enolase, S100B, and glial fibrillary acidic protein levels as outcome predictors in patients with severe traumatic brain injury.
21311479 2010 [Levels of S100? protein in patients with mild traumamic brain injury].
21303299 2011 S100B protein in neurodegenerative disorders.
21293918 2011 Elevated S100B and neuron specific enolase levels in patients with migraine-without aura: evidence for neurodegeneration?
21273622 2011 The dynamics of serum tumor markers in predicting metastatic uveal melanoma (part 1).
21144594 2011 Glial pathology is modified by age in mood disorders--a systematic meta-analysis of serum S100B in vivo studies.
21112154 2011 Genetic variability within the S100B gene influences the personality trait self-directedness.
21079180 2010 GFAP and S100B are biomarkers of traumatic brain injury: an observational cohort study.
21070816 2011 Risk variants in the S100B gene, associated with elevated S100B levels, are also associated with visuospatial disability of schizophrenia.
21034449 2010 Systemic markers of inflammation are independently associated with S100B concentration: results of an observational study in subjects with acute ischaemic stroke.
20950652 2011 The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
20947022 2010 Structural basis for ligand recognition and activation of RAGE.
20943659 2010 The 1.5 Å crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
20716661 2010 Utility of serum S100B protein for identification of central nervous system involvement in systemic lupus erythematosus.
20708613 2010 Current inhibition of human EAG1 potassium channels by the Ca2+ binding protein S100B.
20686797 2011 Secondary insults following traumatic brain injury enhance complement activation in the human brain and release of the tissue damage marker S100B.
20628824 2011 S100B protein expressions as an independent predictor of early relapse in UICC stages II and III colon cancer patients after curative resection.
20614004 2010 Circulating levels of inflammatory markers in intrauterine growth restriction.
20604725 2010 S100B protein increases in human blood and urine during stressful activity.
20592382 2010 Serum S100B and LDH are not useful in predicting the sentinel node status in melanoma patients.
20591429 2010 S100 proteins interact with the N-terminal domain of MDM2.
20587415 2010 The calcium-binding protein S100B down-regulates p53 and apoptosis in malignant melanoma.
20581773 2010 Body mass index and creatinine clearance are associated with steady-state serum concentrations of the cell damage marker S100B in renal transplant recipients.
20559426 2010 Serum S100B: a potential biomarker for suicidality in adolescents?
20509936 2010 Attention-deficit hyperactivity disorder (ADHD) and glial integrity: S100B, cytokines and kynurenine metabolism--effects of medication.
20473040 2010 Replication association analysis of S100B and cognitive ageing.
20437790 2010 Microemboli from cardiopulmonary bypass are associated with a serum marker of brain injury.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20351179 2010 The calcium-dependent interaction between S100B and the mitochondrial AAA ATPase ATAD3A and the role of this complex in the cytoplasmic processing of ATAD3A.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20105309 2010 Serum levels of S100B and NSE proteins in Alzheimer's disease patients.
20093730 2009 S100B in schizophrenia: an update.
20042890 2010 Immunohistochemical analysis of the S100A1, S100B, CD44 and Bcl-2 antigens and the rate of cell proliferation assessed by Ki-67 antibody in benign and malignant melanocytic tumours.
20036866 2010 S100B protein and near infrared spectroscopy in preterm and term newborns.
20036852 2010 S100 beta protein is increased in fetuses with neural tube defect.
19939849 2010 Oxidative stress-induced S100B protein from placenta and amnion affects soluble Endoglin release from endothelial cells.
19910580 2010 S100B interaction with the receptor for advanced glycation end products (RAGE): a novel receptor-mediated mechanism for myocyte apoptosis postinfarction.
19812958 2010 Dynamics of S100B release into serum and cerebrospinal fluid following acute brain injury.
19705461 2010 Overexpression of human S100B exacerbates cerebral amyloidosis and gliosis in the Tg2576 mouse model of Alzheimer's disease.
19674846 2010 S100B serum levels are closely correlated with body mass index: an important caveat in neuropsychiatric research.
19671853 2009 Differential clinical significance of individual NKG2D ligands in melanoma: soluble ULBP2 as an indicator of poor prognosis superior to S100B.
19654082 [Interest of S100B protein blood level determination for the management of patients with minor head trauma].
19636631 2009 S-100B concentrations predict disease-free survival in stage III melanoma patients.
19558426 2009 Increased mucosal nitric oxide production in ulcerative colitis is mediated in part by the enteroglial-derived S100B protein.
19539717 2009 Increased serum S100B levels in chronic schizophrenic patients on long-term clozapine or typical antipsychotics.
19505208 2009 S100B and brain natriuretic peptide predict functional neurological outcome after intracerebral haemorrhage.
19497163 2009 Association study of astrocyte-derived protein S100B gene polymorphisms with major depressive disorder in Chinese people.
19487970 2010 Change in plasma S100B level after acute spontaneous basal ganglia hemorrhage.
19482672 2009 Urinary S100A1B and S100BB to predict hypoxic ischemic encephalopathy at term.
19468240 2009 S100B serum levels and word memory processing in remitted major depression as reflected by brain potentials.
19330775 2010 Risk variants in the S100B gene predict elevated S100B serum concentrations in healthy individuals.
19307814 2009 Neuron-specific enolase and S-100B are associated with neurologic outcome after pediatric cardiac arrest.
19297317 2009 Modulation of the oligomerization state of p53 by differential binding of proteins of the S100 family to p53 monomers and tetramers.
19229202 2009 Elevated serum levels of the glial marker protein S100B are not specific for schizophrenia or mood disorders.
19221847 2009 Explorative investigation of biomarkers of brain damage and coagulation system activation in clinical stroke differentiation.
19220958 2009 [Changes in plasma S-100 beta and neuron-specific enolase in peri-operative period of orthotopic liver transplantation and its relationship with encephalopathy after operation].
19216510 2009 Formation of monomeric S100B and S100A11 proteins at low ionic strength.
19205880 2009 S100beta protein expression: gender- and age-related daily changes.
19202335 2009 Criteria for a clinically informative serum biomarker in acute ischaemic stroke: a review of S100B.
19183802 2009 Diagnostic accuracy of S100B urinary testing at birth in full-term asphyxiated newborns to predict neonatal death.
19147496 2009 S100B Protein Regulates Astrocyte Shape and Migration via Interaction with Src Kinase: IMPLICATIONS FOR ASTROCYTE DEVELOPMENT, ACTIVATION, AND TUMOR GROWTH.
19103440 2009 A new pathophysiological aspect of S100B in schizophrenia: potential regulation of S100B by its scavenger soluble RAGE.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19042077 2009 Amniotic fluid S100B protein and erythropoietin in pregnancies at risk for fetal hypoxia.
19011512 2008 Serological and immunohistochemical analysis of S100 and new derivatives as markers for prognosis in patients with malignant melanoma.
18982242 2008 The effects of gender and numbers of depressive episodes on serum S100B levels in patients with major depression.
18948614 2009 Clinical usefulness of a biomarker-based diagnostic test for acute stroke: the Biomarker Rapid Assessment in Ischemic Injury (BRAIN) study.
18939940 2008 No association of the rs9722 C >T in the S100B gene and susceptibility to major depression in a Chinese population.
18854308 2008 Distinct roles of heterogeneous nuclear ribonuclear protein K and microRNA-16 in cyclooxygenase-2 RNA stability induced by S100b, a ligand of the receptor for advanced glycation end products.
18805362 2008 Tau and S100B proteins as biochemical markers of bilirubin-induced neurotoxicity in term neonates.
18783450 2009 Serum concentrations of s100b and NSE in migraine.
18706914 2008 Identification of a dimeric intermediate in the unfolding pathway for the calcium-binding protein S100B.
18614943 2008 Serum S-100beta response to exercise-heat strain before and after acclimation.
18596106 2008 Human immunodeficiency virus type 1 nef expression prevents AP-2-mediated internalization of the major histocompatibility complex class II-associated invariant chain.
18587628 2008 IQ motif selectivity in human IQGAP1: binding of myosin essential light chain and S100B.
18552513 2008 Increased S100beta is associated with reduced cognitive function in healthy older adults.
18494933 2008 S100B induces tau protein hyperphosphorylation via Dickopff-1 up-regulation and disrupts the Wnt pathway in human neural stem cells.
18454941 2008 Biological and methodological features of the measurement of S100B, a putative marker of brain injury.
18451356 2008 Overexpression of human S100B exacerbates brain damage and periinfarct gliosis after permanent focal ischemia.
18445708 2008 Novel interaction of the dopamine D2 receptor and the Ca2+ binding protein S100B: role in D2 receptor function.
18385926 2008 Serum levels of S100B are decreased in chronic starvation and normalize with weight gain.
18384084 2008 Analysis of the structure of human apo-S100B at low temperature indicates a unimodal conformational distribution is adopted by calcium-free S100 proteins.
18337650 2008 S100B in bone marrow aspirates in healthy individuals and malignant melanoma patients.
18193148 2008 Serum levels of S100B, S100A1B and S100BB are all related to outcome after severe traumatic brain injury.
18181515 2007 Evaluation of an alternative S100b assay for use in cardiac surgery: relationship with microemboli and neuropsychological outcome.
18173564 2008 Serum S100b (astrocyte-specific protein) is a useful marker of hepatic encephalopathy in patients with fulminant hepatitis.
18039581 2008 Expression, purification and fluorine-18 radiolabeling of recombinant S100 proteins--potential probes for molecular imaging of receptor for advanced glycation endproducts (RAGE) in vivo.
17984939 2007 Evening and morning plasma levels of protein S100B in patients with obstructive sleep apnea.
17984926 2007 The diagnostic utility of S-100B protein and TPA in patients with ischemic stroke.
17984171 2008 Genomic and functional profiling of human Down syndrome neural progenitors implicates S100B and aquaporin 4 in cell injury.
17955279 2008 Expression of S100B protein levels in serum and cerebrospinal fluid with different forms of neuropsychiatric systemic lupus erythematosus.
17726019 2007 S100B and S100A6 differentially modulate cell survival by interacting with distinct RAGE (receptor for advanced glycation end products) immunoglobulin domains.
17719207 2007 Increased S100B protein serum levels in psoriasis.
17705023 2007 Serum S100B levels in X-linked adrenoleukodystrophy and Gaucher disease.
17678654 2007 Enteric glial-derived S100B protein stimulates nitric oxide production in celiac disease.
17661202 2007 A Comparison of 3 tumor markers (MIA, TA90IC, S100B) in stage III melanoma patients.
17660747 2007 Structural and functional insights into RAGE activation by multimeric S100B.
17624933 2007 The calcium binding protein, S100B, is increased in the amniotic fluid of women with intra-amniotic infection/inflammation and preterm labor with intact or ruptured membranes.
17579612 2007 Evidence for the association of the S100beta gene with low cognitive performance and dementia in the elderly.
17536784 2007 Amide exchange shows calcium-induced conformational changes are transmitted to the dimer interface of S100B.
17525977 2007 Candidate gene analysis of 21q22: support for S100B as a susceptibility gene for bipolar affective disorder with psychosis.
17408991 2007 Measurements of cerebrospinal fluid concentrations of S100beta protein during and after thoracic endovascular stent grafting.
17396138 2007 S100A1 and S100B, transcriptional targets of SOX trio, inhibit terminal differentiation of chondrocytes.
17348038 2007 S100B in neuropathologic states: the CRP of the brain?
17264538 2007 S-100B protein and melanoma inhibitory activity protein in uveal melanoma screening. A comparison with liver function tests.
17199889 2007 Evidence for a wide extra-astrocytic distribution of S100B in human brain.
17091777 Effect of alcohol detoxification on serum S-100B levels of alcohol-dependent individuals.
17043297 2006 Increased cerebrospinal fluid and serum levels of S100B in first-onset schizophrenia are not related to a degenerative release of glial fibrillar acidic protein, myelin basic protein and neurone-specific enolase from glia or neurones.
17023485 2006 S100B protein expression in the amnion and amniotic fluid in pregnancies complicated by pre-eclampsia.
17020600 2006 Early postoperative serum S100 beta levels predict ongoing brain damage after meningioma surgery: a prospective observational study.
17010455 2006 Recognition of the tumor suppressor protein p53 and other protein targets by the calcium-binding protein S100B.
17008613 2006 Plasma S100B level after acute spontaneous intracerebral hemorrhage.
16931519 2006 Interferon-gamma-inducible protein (IP)-10 mRNA stabilized by RNA-binding proteins in monocytes treated with S100b.
16511125 2005 Purification, crystallization and preliminary X-ray diffraction studies on human Ca2+-binding protein S100B.
16340181 2006 Urinary S-100B concentrations in term and preterm infants at risk for brain damage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16143320 2006 Serum S100B levels in patients with neural tube defects.
15820773 2005 Ontogenetic changes in serum S100B in Down syndrome patients.
15781852 2005 Proteins of the S100 family regulate the oligomerization of p53 tumor suppressor.
15708543 2005 S100B protein levels in saliva: correlation with gestational age in normal term and preterm newborns.
15670788 2005 SNPs and haplotypes in the S100B gene reveal association with schizophrenia.
15556616 2004 S100B-modulated Ca2+-dependent ROS-GC1 transduction machinery in the gustatory epithelium: a new mechanism in gustatory transduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15306236 2004 Expression levels of cytoskeletal proteins indicate pathological aging of S100B transgenic mice: an immunohistochemical study of MAP-2, drebrin and GAP-43.
15257081 2004 Changes in CSF S100B and cytokine concentrations in early-phase severe traumatic brain injury.
15236402 2004 Increased susceptibility of S100B transgenic mice to perinatal hypoxia-ischemia.
15178678 2004 Inhibiting S100B restores p53 levels in primary malignant melanoma cancer cells.
15033494 2004 S100 protein translocation in response to extracellular S100 is mediated by receptor for advanced glycation endproducts in human endothelial cells.
14997170 2004 S100B serum levels and long-term improvement of negative symptoms in patients with schizophrenia.
14967825 2004 Human S100B protein interacts with the Escherichia coli division protein FtsZ in a calcium-sensitive manner.
14699277 2004 Protein S-100b for individual prediction of functional outcome in spinal epidural empyema.
14675567 2004 Serum levels of neural protein S-100B in phenylketonuria.
14661952 2003 Structure of the Ca2+/S100B/NDR kinase peptide complex: insights into S100 target specificity and activation of the kinase.
14642437 2003 Amyotrophic lateral sclerosis: disease stage related changes of tau protein and S100 beta in cerebrospinal fluid and creatine kinase in serum.
14530578 2003 Serum S-100B protein as a molecular marker in severe traumatic brain injury.
12927678 2003 S100B testing in pregnancy.
12746458 2003 Calcium-regulated interaction of Sgt1 with S100A6 (calcyclin) and other S100 proteins.
12645009 2003 S100B in brain damage and neurodegeneration.
12636931 2003 Amniotic fluid levels of S100B protein in normal and trisomy-21 foetuses.
12630517 2003 Serum S 100 B: a marker of brain damage in traumatic brain injury with and without multiple trauma.
12569284 2003 Serum S100B is suitable for prediction and monitoring of response to chemoimmunotherapy in metastatic malignant melanoma.
12527118 2003 Human milk contains S100B protein.
12505619 2003 Cerebrospinal fluid S100B correlates with brain atrophy in Alzheimer's disease.
12493777 2003 Mechanism of Ca2+-mediated regulation of NDR protein kinase through autophosphorylation and phosphorylation by an upstream kinase.
12490005 2002 Serum S100B concentrations are increased after closed head injury in children: a preliminary study.
12480931 2003 A novel S100 target conformation is revealed by the solution structure of the Ca2+-S100B-TRTK-12 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470955 2002 Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12.
12469878 2002 Developmental changes in S100B content in brain tissue, cerebrospinal fluid, and astrocyte cultures of rats.
12377780 2002 The zinc- and calcium-binding S100B interacts and co-localizes with IQGAP1 during dynamic rearrangement of cell membranes.
12351263 2002 A glial-derived protein, S100B, in neonates and infants with congenital heart disease: evidence for preexisting neurologic injury.
12118070 2002 S100A13 and S100A6 exhibit distinct translocation pathways in endothelial cells.
12042313 2002 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family.
11969402 2002 The C-terminus and linker region of S100B exert dual control on protein-protein interactions with TRTK-12.
11527429 2001 Binding to intracellular targets of the metastasis-inducing protein, S100A4 (p9Ka).
11312263 2001 The giant protein AHNAK is a specific target for the calcium- and zinc-binding S100B protein: potential implications for Ca2+ homeostasis regulation by S100B.
11264299 2001 S100beta interaction with tau is promoted by zinc and inhibited by hyperphosphorylation in Alzheimer's disease.
10913138 2000 S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo.
10876243 2000 Structure of the negative regulatory domain of p53 bound to S100B(betabeta).
10830953 2000 The DNA sequence of human chromosome 21.
10531386 1999 N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression.
10510252 1999 The calcium-modulated proteins, S100A1 and S100B, as potential regulators of the dynamics of type III intermediate filaments.
10399917 1999 RAGE mediates a novel proinflammatory axis: a central cell surface receptor for S100/calgranulin polypeptides.
9925766 1999 Demonstration of heterodimer formation between S100B and S100A6 in the yeast two-hybrid system and human melanoma.
9923610 1999 Identification and cloning of a novel cellular protein Naf1, Nef-associated factor 1, that increases cell surface CD4 expression.
9883272 1998 Annexin VI binds S100A1 and S100B and blocks the ability of S100A1 and S100B to inhibit desmin and GFAP assemblies into intermediate filaments.
9774336 1998 Calcium regulation of Ndr protein kinase mediated by S100 calcium-binding proteins.
9519411 1998 A novel calcium-sensitive switch revealed by the structure of human S100B in the calcium-bound form.
9335118 1997 Assignment and secondary structure of calcium-bound human S100B.
8894274 1996 Identification of an S100A1/S100B target protein: phosphoglucomutase.
8750867 1995 beta-Amyloid regulates gene expression of glial trophic substance S100 beta in C6 glioma and primary astrocyte cultures.
8701470 1996 The S100 family of EF-hand calcium-binding proteins: functions and pathology.
8341667 1993 Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E.
8202493 1994 Astrocytosis and axonal proliferation in the hippocampus of S100b transgenic mice.
7759097 1995 Isolation of a YAC clone covering a cluster of nine S100 genes on human chromosome 1q21: rationale for a new nomenclature of the S100 calcium-binding protein family.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
6487634 1984 Purification, characterization and ion binding properties of human brain S100b protein.
4031854 1985 Characterization of human brain S100 protein fraction: amino acid sequence of S100 beta.
3111527 1987 Comparison of S100b protein with calmodulin: interactions with melittin and microtubule-associated tau proteins and inhibition of phosphorylation of tau proteins by protein kinase C.
2964086 1988 Gene encoding the beta subunit of S100 protein is on chromosome 21: implications for Down syndrome.
2833519 1988 Interactions between the microtubule-associated tau proteins and S100b regulate tau phosphorylation by the Ca2+/calmodulin-dependent protein kinase II.
2530061 1989 Refined sublocalization of the human gene encoding the beta subunit of the S100 protein (S100B) and confirmation of a subtle t(9;21) translocation using in situ hybridization.
2394738 1990 Cloning and expression of the human S100 beta gene.
1998503 1991 Structure and chromosome assignment of human S100 alpha and beta subunit genes.