Property Summary

NCBI Gene PubMed Count 235
PubMed Score 2192.82
PubTator Score 1201.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (36)

Protein-protein Interaction (5)

Gene RIF (189)

PMID Text
26878232 The frequency of S100A8+ cells in del(5q) myelodysplastic syndrome human bone marrow positively correlates with disease severity.
26745257 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma
26525587 Data suggest up-regulation of pro-inflammatory molecules TLR9, S100A8, and IL-8 plus lower levels of CD11b+ CD33+ myeloid cells may be involved in impairment of wound healing in type 2 diabetes leading to chronic ulcers, such as diabetic foot ulcers.
26438270 Treg cells suppress the activity of cytotoxic T cells, which kill malaria parasites; therefore, the up-regulation of S100A8 in malaria patients may contribute to pathogen immune escape or tolerance.
26404752 We found that tumor cell proliferation was diminished in the absence of S100A8/A9, leading to significant reduction of tumor size.
26397389 BBP exposure also increased tumor infiltrating myeloid-derived suppressor cell (MDSC) secretion of S100A8/A9, thereby exacerbating the resistance of breast cancer to doxorubicin with cyclophosphamide
26296369 results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation
26266960 Increased soluble gp130 in older patients may inhibit IL-6 trans-signaling, impair barrier function, and decrease S100A8/ S100A9 production in elderly chronic rhinosinusitis patients with asthma and nasal polyps.
26223295 Elevated expression of MRP8/14 are associated with poor prognosis in lupus nephritis.
26110394 High S100A8 expression is associated with Refractory Lupus Nephritis.
26006104 Oxidative stress associated with inflammation in cystic fibrosis will stop metal sequestration by calprotectin.
25970343 Calprotectin levels correlated positively, though weakly, with platelet aggregation and activation.
25916224 Fecal calprotectin levels were significantly higher in patients with pouchitis than those without pouchitis after restorative proctocolectomy for ulcerative colitis.
25823769 Lower fecal calprotectin was associated with mucosal healing in ulcerative colitis assessed by colonoscopy.
25811984 We hypothesize that RAGE and S100A8/A9 contribute to the development of human SCC by modulating keratinocyte growth and migration.
25789858 This is the first structure-based docking study for the selected protein targets and anticancer drug, and S100A8 and EGFR are attractive anticancer targets and midostaurin with effective drug properties for therapeutic intervention in kidney cancer
25781366 Fecal calprotectin concentrations were significantly higher in Crohn's disease patients with endoscopic recurrence after ileocolonic resection when compared with those in endoscopic remission.
25673070 Serum and mRNA expression levels of S100A8 and S100A9 were found to be upregulated in patients with renal cell carcinoma compared with the other three groups.
25620670 Fecal calprotectin measurement has sufficient sensitivity and NPV values to monitor for Crohn's disease recurrence after intestinal resection.
25505274 by independent functional experiments. Our data confirm the primary importance of the TLR4/MRP8 axis in the activation of human monocytes
25423568 These findings establish a novel role for S100A8 in the promoting and enhancing of anaplastic thyroid carcinoma progression
25369978 Fecal calprotectin appears to be a reliable biomarker of intestinal inflammation and differentiates inflammatory from functional intestinal disorders.
25348783 Low S100A8 mRNA levels were associated with Prostate Cancer.
25342131 Circulating MRP8/MRP14 levels in blunt trauma nonsurvivors were significantly lower than those of survivors. Monocytic THP-1 cells stimulated with MRP8/MRP14 expressed the chemokine IFN-gamma inducible protein 10 (IP-10)/CXCL10.
25308296 S100A9 and S100A8 may be involved in inducing damage-associated molecular pattern (DAMP)-mediated inflammation in atopic dermatitis triggered by IL-17A and house-dust mites.
25302747 Worse overall survival of OPSCC patients with simultaneous reduction of S100A8 and S100A12 expression.
25267955 Fecal calprotectin has good diagnostic accuracy in detecting mucosal inflammatory changes in inflammatory bowel disease patients in clinical remission.
25252120 Association of increased S100A8 serum protein with early pregnancy loss
25236491 Data suggest that intracellular S100A8/A9 contributes to the cancer cell phenotype by modulating matrix metallopeptidase 2 (MMP-2) expression and activity to regulate cell migration and mobility.
25228509 The study showed a high incidence of strains with increased virulence, possessing cagA, vacAs1 and iceA1 genes in symptomatic children with H. pylori infection.
25180294 Alarmins S100A8/S100A9 aggravate osteophyte formation in experimental osteoarthritis and predict osteophyte progression in early human symptomatic osteoarthritis.
25179566 Results do not support an important role for serum S100A8/A9 levels as a biomarker for clinical and structural characteristics in established knee, hip, and hand osteoarthritis patients.
25098409 TLR9 ligands induce S100A8 in macrophages via a STAT3-dependent pathway which requires IL-10 and PGE2.
24983324 The increased expression of S100A8 protein in poor prognosis chronic lymphocytic leukemia patients
24975020 these data reveal the capacity of these three S100 proteins to induce MUC5AC production in airway epithelial cells, suggesting that they all serve as key mediators linking neutrophil-dominant airway inflammation to mucin hyperproduction.
24956170 IL-10 blockade and recombinant IFN-gamma treatment partially abrogated S100A8/A9 mRNA increases in endotoxin tolerance.
24955375 Serum levels of S100A8/S100A9 reflect the degree of inflammation and disease activity in patients with psoriatic arthritis.
24825356 S100A8/9 may be an upstream trigger for inflammation and other disease pathways in pterygium.
24820971 S100A8 contributes to drug resistance by promoting autophagy in leukemia cells
24718960 S100A8/A9 was robustly found to be elevated in the circulation of systemic sclerosis patients.
24692722 distinct transcriptomic signatures, with significantly high levels of S100A8, and underlying molecular mechanisms contributing to kidney cancer progression.
24622086 Data indicate that the plasma levels of S100A9, S100A8, and S100A12 were elevated in acute pancreatitis but a definitive difference between the severe and mild forms of the disease.
24595267 Calcium dependency on formation of S100A8 or A9 dimers might be the prerequisite for altering monolayer permeability of human umbilical endothelial cells.
24583746 Severe and prolonged left lower-abdominal pain seems to be the best symptom characterizing symptomatic uncomplicated colonic divertulosis and correlates with fecal calprotectin expression.
24558454 Glomerular MRP8 expression appears to be associated with progression of proteinuria in obese or type 2 diabetic patients
24470119 Myeloid-related proteins 8 and 14 contribute to monosodium urate monohydrate crystal-induced inflammation in gout.
24461178 Serum levels of MRP-8/MRP-14 complex were positively correlated with the number of endothelial cells in the circulation (r=0.69, P<0.05).
24439044 We focus on S100A8 and S100A9 which are involved in the regulation of neutrophil chemotaxis and inflammation related to ocular surface diseases such as dry eye, meibomian gland dysfunction, pterygium, and corneal neovascularization.
24334497 Inhibition of S100A8 resulted in significant growth reduction and apoptosis acceleration in fibroblasts derived from hypertrophic scars.
24326364 Data indicate that moderate or high expression of S100A8 or S100A9 proteins was associated with a median disease recurrence-free survival.
24202303 Study supports the value of S100A8/A9 as a potentially important link between neutrophils, traditional cardiovascular risk factors, and CV disease.
24177755 S100A8/A9 at low concentrations promoted metastasis and invasion of breast cancer cells and RAGE was required for cell metastasis and invasion mediated by S100A8/A9.
24122301 These data demonstrate for the first time that S100A8/A9 expression in epithelial cancer cells causes enhanced infiltration of immune cells, especially neutrophils, and stimulates settlement of the cancer cells in the lung.
24114735 Elevated levels of S100A8 and UBE2C were observed.
24077667 The aim was to study fecal MMP-9 and HBD-2 in pediatric inflammatory bowel disease to compare their performance to calprotectin and to study whether they would provide additional value in categorizing patients according to their disease subtype.
24041785 Microarray analysis indicated that rIL-22 enhances the expression of calgranulin A. Calgranulin A small interfering RNA (siRNA) abrogated rIL-22-dependent growth inhibition of M. tuberculosis in MDMs.
24041228 S100A8 and S100A9 appear to suppress breast cancer malignancy through an increase in mesenchymal to epithelial transitioning.
23977231 S100A8 and S100A9 regulate the NLRP3 inflammasome and enhance the inflammatory response by inducing cytokine secretion of peripheral blood mononuclear cells.
23954397 Studies indicate that RAGE and Toll-like receptor (TLR) share several common ligands including HMGB1, the S100A8/A9 heterodimeric protein complex and LPS.
23942785 associated with cardiovascular disease in patients with inactive systemic lupus erythematosus
23915068 calgranulin A and B distinguish borderline and malignant ovarian tumors from benign tumors
23907944 A study of expression of S100 proteins in gallbladder mucosa of the patients with calculous cholecystitis indicated close relationship between S100A8 and S100A9 proteins in their proinflammatory functions.
23874958 S100A8/A9 (calprotectin) negatively regulates G2/M cell cycle progression and growth of squamous cell carcinoma.
23850136 Data suggest that expression of S100A8 and S100A9 mRNA and protein is up-regulated in endometrial decidua of patients with recurrent early pregnancy loss as compared to controls suggesting roles of these proteins in pregnancy maintenance/failure.
23800059 p38 MAPK signalling pathway plays a key role in the TNFalpha- and IL-17A-induced expression of S100A8 in cultured human keratinocytes
23637971 S100A8 and S100A9 are linked to the colorectal cancer progression.
23626736 S100A9 protein is extremely unstable but can be rescued upon co-expression with S100A8 protein or inflammatory stimuli, via proteolytically resistant homodimer formation.
23456298 S100A8/A9 promotes cell migration and invasion through p38 MAPKdependent NF-kappaB activation leading to an increase of MMP2 and MMP12 in gastric cancer.
23431180 The S100A8/S100A9 heterodimer calprotectin (CP) functions in the host response to pathogens through a mechanism termed "nutritional immunity." CP binds Mn(2+) and Zn(2+) with high affinity and starves bacteria of these essential nutrients.
23426492 The influence of immunosuppressive drugs on S100A8/A9-RAGE mRNA expression may suggest a role of these proteins in early-stage SCC development in immunosuppressed patients
23423260 Serum calprotectin (s100A8/S100A9)is a potential disease biomarker in patients with ANCA-associated vasculitis and glomerulonephritis, and may have a role in disease pathogenesis.
23378728 In inflamed limbal tissues, expression of S100 A4,8,9 and B proteins is dramatically decreased.
23320892 Levels of S100A8/A9 and sIL-2R, but not ACE or lysozyme, are elevated in the serum of patients with Hidradenitis suppurativa.
23299480 Our study demonstrated a dual role for MRP8/14 in bacterial keratitis.
23248262 S100A8/A9, produced by myeloid-derived suppressor cells, plays a role in myeloid-derived suppressor cells activation in gastric cancer patients, identifying S100A8/A9 as a potential target for gastric cancer treatment.
23165982 As(III) enhanced S100A8 and S100A9 expression in human-derived cells, and As(III)-induced S100A9 expression is dependent on Nrf2 activation.
23018243 these findings suggest that S100A8 and S100A9 are negative regulators of lymph node metastasis of gastric adenocarcinoma and can be used as biomarkers for prediction of lymph node metastasis in gastric adenocarcinoma.
22808130 The data point to four strategic (87)HEES(90) amino acid residues of the S100A8 C-terminal sequence that are involved directly in the molecular interaction with cytochrome b(558) and then in the phagocyte NADPH oxidase activation.
22806545 Compared with benign gallbladder diseases, consistently elevated S100A8 levels in malignant gallbladder bile and tissue indicate that gallbladder cancer is an inflammation-associated cancer.
22728165 In prostate cancer cells, S100A8 expression is stimulated by prostaglandin E2 via EP2 and EP4 receptors through activation of the protein kinase A signaling pathway and stimulation of CCAAT/enhancer-binding-protein-beta binding to the S100A8 promoter.
22683330 the upregulated production of S100A8 and S100A9 by psoriatic epidermal keratinocytes activated adjacent keratinocytes to produce several cytokines.
22660800 The data suggest that serum S100A8/A9 may be a useful biomarker for evaluating disease activity in patients with adult-onset Still's disease.
22634002 The upregulation of S100A8/A9 in tumor-infiltrated myeloid cells could be triggered by IL-6 and IL-8 released from myofibroblasts.
22622474 Elevated levels of S100A8 is associated with increased aggressiveness in breast cancer.
22555971 Fecal calprotectin and alpha(1)-AT levels at the time of diagnosis are predictive for responses to treatment but are not diagnostic markers for initial stage 1 to 3 gastrointestinal graft-versus-host disease.
22505354 identified hypoxia and HIF-1 as novel regulators of S100A8/A9 expression in prostate cancer. S100A9 might be useful as prognostic marker for prostate cancer recurrence after radical prostatectomy
22446997 Patients presenting with MI had elevated levels of serum MRP-8/14 compared to patients with non-cardiac chest pain. However, overall diagnostic performance of MRP-8/14 was poor.
22420238 Faecal calprotectin in the diagnosis of inflammatory bowel disease.
22381691 Report role for MRP8 for exaggerated in-stent restenosis in diabetes mellitus type 2.
22363402 S100 A8/9 complex regulates cell survival via a signaling mechanism involving MEK-ERK via TLR4.
22318783 sustained activation of S100A8/A9 critically contributes to the development of post-ischemic heart failure (HF) driving the progressive course of HF through activation of RAGE.
22282267 Elevated S100A8 expression causes glucocorticoid resistance in MLL-rearranged infant acute lymphoblastic leukemia.
22209981 Involvement of the danger molecule S100A8/A9 in the resistance against viruses.
22139384 Results suggest that miR-24 may function as a tumor suppressor in laryngeal squamous cell carcinoma through down-regulation of S100A8.
22127564 Alarmins S100A8 and S100A9 elicit a catabolic effect in human osteoarthritic chondrocytes that is dependent on Toll-like receptor 4.
21961943 S100A8 may be involved in the exacerbation of rheumatoid arthritis.
21912088 current understanding of the pro- and anti-tumorigenic functions of S100A8 and S100A9.
21799753 Cell proteins associated with M1 and M2 macrophages are also expressed by other cell types in the tumour islets and stroma of patients with non-small cell lung cancer
21791097 S100A8/9 might potentially be a predictive marker for improvement in the total number of swollen joints in patients in the early phase of rheumatoid arthritis
21766173 Serum MRP8/14 complex levels might be associated with the severity of renal injury and endothelial cell dysfunction in Henoch-Schonlein purpura nephritis patients.
21592353 Increased serum myeloid-related protein 8/14 level is associated with atherosclerosis in type 2 diabetic patients.
21492422 Patients with Systemic lupus erythematosus had increased cell surface S100A8/A9, which could be important in amplification and persistence of inflammation
21472666 The cytokine-induced potentiated S100A8 and S100A9 expression under conditions with a high AGE burden is able to aggravate proinflammatory conditions via activation of the RAGE pathway.
21463326 These findings indicate that aggressive periodontitis is associated with elevated levels of plasma calprotectin and that gene polymorphisms of S100A8 may influence the susceptibility and severity of aggressive periodontitis.
21434523 The strongest expression of S100A8 was found in severe dysplasias and carcinoma in situ for squamous cell carcinoma
21334078 A combination of S100A8/A9 complex and IL-6 provided powerful predictive value in mortality for both 6 and 12 months in patients with severe heart failure.
21239714 FcgammaR-mediated phagocytosis of neutrophils requires the complex formed by S100 calcium-binding protein-A8 and -A9 as the site of interplay between extracellular calcium entry and intraphagosomal reactive oxygen species production.
21228116 These results thus reveal a novel role for myeloid-derived S100A8/A9 in activating specific downstream genes associated with tumorigenesis and in promoting tumor growth and metastasis.
21192933 S100A8/A9 is induced in epithelial cells in response to stress
21072048 the expression of S100A8 in leukemic cells is a predictor of low survival.
21067798 Observational study of gene-disease association. (HuGE Navigator)
20833513 These results validate the differential expressions of SOD2, S100A8 and FABP5 between mycosis fungoides tissues and normal skins.
20819668 S100A8, S100A9 was up-regulated in the lung adenocarcinoma and end stage lung cancer tissue, the correlation of their higher expression in inflammatory lung tissues indicate the collaborative effect of inflammation on the progression of cancer.
20717964 Data show that NT-S100A8 exerts a mild effect on pancreatic cancer (PC) cell growth and reduces PC cell invasion.
20594128 Studies indicate that both calprotectin and lactoferrin are markers of inflammatory bowel disease.
20555353 bacterial flagellin induces the upregulation of S100A8/S100A9 via a TLR5-dependent mechanism in epidermal keratinocytes
20219570 Results characterize a pathway leading to NOX2 activation in which iPLA(2)-regulated p38 MAPK activity is a key regulator of S100A8/A9 translocation via S100A9 phosphorylation.
20172281 Fecal calprotectin dosage shows a good sensitivity but low specificity for the diagnosis of intestinal rejection.
20096140 S100A8 may have a role in disease progression in non-muscle invasive bladder cancer
19957061 S100A8 and S100A9 have inhibitory effects on the proliferation of CaSki carcinoma cells by inducing cell apoptosis and on the invasiveness of CaSki cells.
19935772 S100A8-induced cell death involves BNIP3 and increase of ROS production by mitochondria, subsequently followed by mitochondrial damage and lysosomal activation.
19898558 S100A8/A9 could underpin chronic airway inflammation and airway remodeling in asthma by inducing effector responses of resident and infiltrating airway cells--REVIEW
19823685 Plasma calprotectin has a role in obesity in individuals without type 2 diabetes
19755614 Serum levels of S100A8/A9 are significantly raised in SLE versus pSS patients and healthy controls and can be correlated to a disease activity index.
19752232 S100A8/A9 kills Finegolidia magna bacteria of strain 505 via a bactericidal effect which most likely is a consequence of an interaction of S100A8 with the cell membrane, causing lysis of the bacteria.
19695969 a single measurement of faecal calprotectin is not sufficiently accurate to identify patients with significant colorectal disease; a normal result can help rule out organic disease among patients with diarrhoea or abdominal pain and/or constipation.
19670424 S100A8 and S100A9 are novel nuclear factor kappa B target genes during malignant progression of murine and human liver carcinogenesis.
19608587 Plasma MRP8/14 levels are associated with paediatric obstructive sleep apnea and may reflect increased risk for cardiovascular morbidity
19601998 Observational study of gene-disease association. (HuGE Navigator)
19530996 increased expression in sera, synovial tissue and in PBMC of rheumatoid arthritis patients
19466434 expression increases at 24 h (3.0-fold) and 48 h (4.4-fold) after UV skin irradiation
19440546 Data suggest a link between bacterial infection, inflammation and amyloid deposition of S100A8/A9 in the prostate gland, such that a self-perpetuating cycle can be triggered and may increase the risk of malignancy in the ageing prostate.
19284577 Serum S100A9, S100A8 and S100A12 and RAGE levels were associated not just with RA inflammation and autoantibody production but also with classical vascular risk factors for end-organ damage.
19248102 MRP-8/MRP-14 and IL-1beta represent a novel positive feedback mechanism activating phagocytes via 2 major signaling pathways of innate immunity during the pathogenesis of systemic-onset juvenile idiopathic arthritis.
19232095 MRP8/14 may be a potentially selective novel biomarker for microcirculatory defects in diabetic nephropathy.
19210342 This family-based association study supports the previous findings that SNP rs3795391 (A > G) of the S100A8 gene might contribute to aggressive periodontitis susceptibility
19210342 Observational study of gene-disease association. (HuGE Navigator)
19201880 S100A8 was induced in human monocytes and macrophages, by polyinosinic:polycytidylic acid, a dsRNA mimetic
19186948 S100A8 and S100A9 as candidates for serological biomarkers in combination with other serum markers that aid CRC diagnosis.
19087201 Data indicate that both S100A8 and S100A9 are required for their fully active antifungal effect and that oxidation regulates S100A8/A9 antifungal activity through mechanisms that remain to be elucidated and evaluated.
19079333 Calprotectin mobilization was listeriolysin O-dependent and required calcium
18922970 This study revealed S100A8/A9 genes as candidate markers for metastatic potential of breast epithelial cells.
18832721 S100A8-SNO may regulate leukocyte-endothelial cell interactions in the microcirculation, and suppression of mast cell-mediated inflammation represents an additional anti-inflammatory property for S100A8.
18786929 annexin A6 contributes to the calcium-dependent cell surface exposition of the membrane associated-S100A8/A9 complex
18689872 RAGE, carboxylated glycans and S100A8/A9 play essential roles in tumor-stromal interactions, leading to inflammation-associated colon carcinogenesis.
18588753 Expression of S100A7 and S100A8 was significantly decreased in CRS with and without nasal polyps when compared with controls.
18537548 It is suggested that S100A8 is S100A9-dependently expressed and acquires the protein stability by S100A8/A9 heterocomplex formation; S100A8 and S100A9 overexpression should be considered marker of poor prognosis in invasive ductal carcinoma
18374411 Seven placental transcripts characterize HELLP-syndrome.
18339893 S100A8/A9-promoted cell growth occurs through RAGE signaling and activation of NF-kappaB.
18060880 These data indicate that S100A8/A9-induced cell death involves Bak, selective release of Smac/DIABLO and Omi/HtrA2 from mitochondria, and modulation of the balance between pro- and anti-apoptotic proteins.
18044712 presence of a positive feedback loop for growth stimulation involving S100A8/A9 and cytokines in human epidermal keratinocytes
17936757 The homo-oligomeric forms of S100A8 and S100A9 are readily degraded by proteases, and the preferred hetero-oligomeric S100A8/A9 complex displays a high resistance even against proteinase K degradation.
17895549 MRP8/14 may be involved in the pathogenesis of sarcoid granulomas. The measurement of serum MRP8/14 levels is useful for the diagnosis of sarcoidosis.
17852869 Serum calprotectin (S100A8/S100A9)and S100A12 are increased in children with inflammatory bowel disease and indicate disease activity.
17787039 Data suggest that S100 proteins calprotectin and S100A12 are related to radiographic changes rather than disease activity in psoriatic arthritis with low disease activity.
17644317 S100A8 is regulated by IL-17, dexamethasone, IL-4 and IL-13 in HaCat cells (human keratinocyte cell line)
17636430 Report showed S100A8 was expressed human bone and cartilage cells and may contribute to calcification of the cartilage matrix and its replacement with trabecular bone, and to regulation of redox in bone resorption.
17557234 mechanism of S100A8 in the oncogenesis and development of laryngeal cancer
17469085 Correlation of the expression of S100A8 and S100A9 revealed that the microenvironments of tumours which lacked expression of Smad4, had significantly reduced numbers of S100A8-immunoreactive (p = 0.023) but not S100A9-immunoreactive (p = 0.21) cells.
17429438 HaCaT keratinocytes overexpressing the S100 proteins S100A8 and S100A9 show increased NADPH oxidase and NF-kappaB activities.
17197440 the effect of calcium on telomerase in the human epidermal keratinocyte line HaCaT showed calcium directly interacts with the telomerase complex. This interaction could be mediated by the calcium-binding protein S100A8
17090475 S100A8 and S100A9 are involved in the innate defense of the bronchial epithelium
17069562 Observational study of gene-disease association. (HuGE Navigator)
17069562 The G+ genotype/G allele may be considered to exert a significant protective effect in males against aggressive periodontitis.
17050004 Zinc-binding, like calcium, induces (S100A8/S100A9)(2)-tetramers.
16979015 MRP-8/MRP-14 are exclusively secreted by granulocytes in patients with acute Kawasaki disease, and intravenous immune globulin treatment suppresses their gene expression.
16806487 MRP-8/14 was mainly detected in human cervical mucus and showed a positive correlation with proinflammatory cytokines
16690079 calcium-dependent formation of (S100A8/S100A9)2 tetramers is an essential prerequisite for biological function.
16613612 S100A8/A9 heterodimer, secreted extracellularly from activated tissue macrophages, may amplify proinflammatory cytokine responses in rheumatoid arthritis.
16573830 heterodimeric S100 calcium binding protein A8/S100 calcium binding protein A9 might play a hitherto unknown role in triggering atherosclerosis in diabetes and renal failure
16216873 S100A8 and S100A9 in atherosclerotic plaque and calcifying matrix vesicles may significantly influence redox- and Ca2+-dependent processes during atherogenesis
16033829 data suggest that enhanced expression of S100A8, S100A9, and RAGE is an early event in prostate tumorigenesis and may contribute to development and progression or extension of prostate carcinomas
15816004 Calgranulin A and chaperonin 10 are identified as markers for diagnosis and screening of endometrial carcinoma.
15642721 S100A8/A9 promotes phagocyte NADPH oxidase activation by supplying the enzyme with its cofactor arachidonic acid
15598812 expression of MRP8/MRP14 closely correlated with the inflammatory activity in systemic vasculitis
15331440 The complex of S100A8 and S100A9 promotes tubulin polymerization and integrates mitogen-activated protein kinase- and calcium-dependent signals during migration of phagocytes.
15069705 decreased expression of MRP8 and MRP14 might play an important role in the pathogenesis of human esophageal squamous cell carcinoma, being particularly associated with poor differentiation of tumor cells.
13130482 Since MRP-8/MRP-14 exhibit direct effects on leukocyte adhesion to the vascular endothelium, their extensive expression in the epidermis indicates an active role for these S-100 proteins in the initial phase of this systemic autoimmune disease.
12937135 Activated macrophages can promote destruction and impair regeneration of myocytes during the course of inflammatory myopathies via secretion of S100A8 and S100A9.
12719414 MRP8/MRP14 dimer behaves as a positive mediator of phagocyte NADPH oxidase regulation
12710851 increased levels in fetal disease, premature rupture of membranes, and preterm labor
12697438 S100A8 and S100A9 induce inflammatory activation of endothelial cells [review].
12645005 plays a prominent role in leukocyte trafficking and arachidonic acid metabolism; elevated levels of S100A8 and S100A9 in body fluids of inflamed tissues strengthen the view that these molecules are important players in fighting inflammation [review]
12626582 S100A8 stimulates shedding of L-selectin, up-regulates and activates Mac-1/CD11b, induces neutrophil adhesion to fibrinogen in vitro, and is involved in neutrophil migration to in vivo inflammatory sites.
12489193 S100A8 and S100A9 calcium-binding proteins: localization within normal and cyclosporin A-induced overgrowth gingiva, in spino-cellular layer and extracellularly in desmosomes, in cytoplasm and nuclei.
12480428 Extensive expression of S100A8 and S100A9 defines a novel inflammatory disorder.
12218151 Proinflammatory myeloid-related protein S100A8 induces a dose- and time-dependent activation of the HIV-1 long terminal repeat promoter region that can be blocked by specific polyclonal antibody and by physical denaturation of the protein.
12137245 These data indicate that calprotectin (MRP8 and MRP14)has higher specific activity to induce apoptosis than the individual subunits, and that the mechanism is exclusion of zinc from target cells.
11895856 examination of whether the prevalence of somatic p53 mutation in gastric adenocarcinoma differed between subjects with and without infection with CagA(+) (a marker for the PAI) H. pylori strains

AA Sequence

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE      1 - 70
FLILVIKMGVAAHKKSHEESHKE                                                    71 - 93
//

Text Mined References (251)

PMID Year Title
26878232 2016 Rps14 haploinsufficiency causes a block in erythroid differentiation mediated by S100A8 and S100A9.
26745257 2015 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma.
26525587 Increased expression of TLR9 associated with pro-inflammatory S100A8 and IL-8 in diabetic wounds could lead to unresolved inflammation in type 2 diabetes mellitus (T2DM) cases with impaired wound healing.
26438270 2015 Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
26404752 2015 A pro-tumorigenic function of S100A8/A9 in carcinogen-induced hepatocellular carcinoma.
26397389 2015 Benzyl butyl phthalate increases the chemoresistance to doxorubicin/cyclophosphamide by increasing breast cancer-associated dendritic cell-derived CXCL1/GRO? and S100A8/A9.
26296369 2015 Glycosylation-dependent interaction between CD69 and S100A8/S100A9 complex is required for regulatory T-cell differentiation.
26266960 2015 Age-related increased prevalence of asthma and nasal polyps in chronic rhinosinusitis and its association with altered IL-6 trans-signaling.
26223295 2016 Elevated expressions of myeloid-related proteins-8 and -14 are danger biomarkers for lupus nephritis.
26135667 2015 Inflammation-induced S100A8 activates Id3 and promotes colorectal tumorigenesis.
26110394 2015 Biomarkers for Refractory Lupus Nephritis: A Microarray Study of Kidney Tissue.
26006104 2015 Oxidation of calprotectin by hypochlorous acid prevents chelation of essential metal ions and allows bacterial growth: Relevance to infections in cystic fibrosis.
25970343 2015 Calprotectin and platelet aggregation in patients with stable coronary artery disease.
25916224 2015 Consecutive Monitoring of Fecal Calprotectin and Lactoferrin for the Early Diagnosis and Prediction of Pouchitis after Restorative Proctocolectomy for Ulcerative Colitis.
25823769 2015 Evaluation of Mucosal Healing in Ulcerative Colitis by Fecal Calprotectin Vs. Fecal Immunochemical Test.
25811984 2015 S100A8/A9 stimulates keratinocyte proliferation in the development of squamous cell carcinoma of the skin via the receptor for advanced glycation-end products.
25789858 2015 Molecular interaction of a kinase inhibitor midostaurin with anticancer drug targets, S100A8 and EGFR: transcriptional profiling and molecular docking study for kidney cancer therapeutics.
25781366 2015 Levels of Fecal Calprotectin Are Associated With the Severity of Postoperative Endoscopic Recurrence in Asymptomatic Patients With Crohn's Disease.
25673070 2015 Proteins S100A8 and S100A9 are potential biomarkers for renal cell carcinoma in the early stages: results from a proteomic study integrated with bioinformatics analysis.
25620670 2015 Measurement of fecal calprotectin improves monitoring and detection of recurrence of Crohn's disease after surgery.
25505274 2015 Transcriptome assessment reveals a dominant role for TLR4 in the activation of human monocytes by the alarmin MRP8.
25423568 2015 S100A8 is a novel therapeutic target for anaplastic thyroid carcinoma.
25417112 2014 Target-selective protein S-nitrosylation by sequence motif recognition.
25369978 2014 Fecal calprotectin is an effective diagnostic tool that differentiates inflammatory from functional intestinal disorders.
25348783 2015 Comparison of mRNA, Protein, and Urinary Nucleic Acid Levels of S100A8 and S100A9 between Prostate Cancer and BPH.
25342131 2015 Injury-induced MRP8/MRP14 stimulates IP-10/CXCL10 in monocytes/macrophages.
25308296 2014 DAMP molecules S100A9 and S100A8 activated by IL-17A and house-dust mites are increased in atopic dermatitis.
25302747 2015 High S100A8 and S100A12 protein expression is a favorable prognostic factor for survival of oropharyngeal squamous cell carcinoma.
25267955 2014 Rapid fecal calprotectin level assessment and the SIBDQ score can accurately detect active mucosal inflammation in IBD patients in clinical remission: a prospective study.
25252120 2015 Association of increased S100A8 serum protein with early pregnancy loss.
25236491 2014 S100A8/A9 regulates MMP-2 expression and invasion and migration by carcinoma cells.
25228509 2014 Prevalence of Helicobacter pylori cagA, vacA, iceA, babA2 genotypes in Polish children and adolescents with gastroduodenal disease.
25180294 2016 Alarmins S100A8/S100A9 aggravate osteophyte formation in experimental osteoarthritis and predict osteophyte progression in early human symptomatic osteoarthritis.
25179566 2015 Association between serum levels of the proinflammatory protein S100A8/A9 and clinical and structural characteristics of patients with established knee, hip, and hand osteoarthritis.
25098409 2014 TLR9 ligands induce S100A8 in macrophages via a STAT3-dependent pathway which requires IL-10 and PGE2.
24983324 2014 Proteomics-based strategies to identify proteins relevant to chronic lymphocytic leukemia.
24975020 2015 S100A8, S100A9 and S100A12 activate airway epithelial cells to produce MUC5AC via extracellular signal-regulated kinase and nuclear factor-?B pathways.
24956170 2014 S100A8/A9 mRNA induction in an ex vivo model of endotoxin tolerance: roles of IL-10 and IFN?.
24955375 2014 S-calprotectin (S100A8/S100A9): a potential marker of inflammation in patients with psoriatic arthritis.
24825356 2014 Evaluation of global differential gene and protein expression in primary Pterygium: S100A8 and S100A9 as possible drivers of a signaling network.
24820971 2014 S100A8 contributes to drug resistance by promoting autophagy in leukemia cells.
24718960 2014 Proteomic analysis of plasma identifies the Toll-like receptor agonists S100A8/A9 as a novel possible marker for systemic sclerosis phenotype.
24692722 2014 Impact of S100A8 expression on kidney cancer progression and molecular docking studies for kidney cancer therapeutics.
24622086 2014 Analysis of plasma levels and polymorphisms of S100A8/9 and S100A12 in patients with acute pancreatitis.
24595267 2014 Functional characterization of S100A8 and S100A9 in altering monolayer permeability of human umbilical endothelial cells.
24583746 2015 Moderate to severe and prolonged left lower-abdominal pain is the best symptom characterizing symptomatic uncomplicated diverticular disease of the colon: a comparison with fecal calprotectin in clinical setting.
24558454 2014 Predictive significance of kidney myeloid-related protein 8 expression in patients with obesity- or type 2 diabetes-associated kidney diseases.
24470119 2014 Myeloid-related proteins 8 and 14 contribute to monosodium urate monohydrate crystal-induced inflammation in gout.
24461178 2014 [Expression of myeloid-related protein complex in association with circulating endothelial cells in children with acute Kawasaki disease].
24439044 2014 S100A proteins as molecular targets in the ocular surface inflammatory diseases.
24334497 2014 Effects of downregulation of S100A8 protein expression on cell cycle and apoptosis of fibroblasts derived from hypertrophic scars.
24326364 2014 Potential prognostic biomarkers of pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24202303 2014 Plasma S100A8/A9 correlates with blood neutrophil counts, traditional risk factors, and cardiovascular disease in middle-aged healthy individuals.
24177755 2013 RAGE-binding S100A8/A9 promotes the migration and invasion of human breast cancer cells through actin polymerization and epithelial-mesenchymal transition.
24122301 2014 Impact of S100A8/A9 expression on prostate cancer progression in vitro and in vivo.
24114735 2014 Additive effect of the AZGP1, PIP, S100A8 and UBE2C molecular biomarkers improves outcome prediction in breast carcinoma.
24077667 2014 Fecal calprotectin, MMP-9, and human beta-defensin-2 levels in pediatric inflammatory bowel disease.
24041785 2014 Interleukin 22 inhibits intracellular growth of Mycobacterium tuberculosis by enhancing calgranulin A expression.
24041228 2014 Intracellular expression of inflammatory proteins S100A8 and S100A9 leads to epithelial-mesenchymal transition and attenuated aggressivity of breast cancer cells.
23977231 2013 S100A8 and S100A9 induce cytokine expression and regulate the NLRP3 inflammasome via ROS-dependent activation of NF-?B(1.).
23954397 2013 RAGE and TLRs: relatives, friends or neighbours?
23942785 2013 Increased serum levels of S100A8/A9 and S100A12 are associated with cardiovascular disease in patients with inactive systemic lupus erythematosus.
23915068 2013 Ovarian cyst fluids are a cache of tumor biomarkers that include calgranulin A and calgranulin B isoforms.
23907944 2013 Tissue expression of S100 proteins in gallbladder mucosa of the patients with calculous cholecystitis.
23874958 2013 S100A8/A9 (calprotectin) negatively regulates G2/M cell cycle progression and growth of squamous cell carcinoma.
23850136 2013 Role of inflammatory proteins S100A8 and S100A9 in pathophysiology of recurrent early pregnancy loss.
23800059 2013 TNF?- and IL-17A-mediated S100A8 expression is regulated by p38 MAPK.
23637971 2013 S100A8 and S100A9 are associated with colorectal carcinoma progression and contribute to colorectal carcinoma cell survival and migration via Wnt/?-catenin pathway.
23626736 2013 Human S100A9 protein is stabilized by inflammatory stimuli via the formation of proteolytically-resistant homodimers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23456298 2013 S100A8 and S100A9 promotes invasion and migration through p38 mitogen-activated protein kinase-dependent NF-?B activation in gastric cancer cells.
23431180 2013 Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
23426492 2013 Influence of cyclosporin and prednisolone on RAGE, S100A8/A9, and NF?B expression in human keratinocytes.
23423260 2013 Leukocyte and serum S100A8/S100A9 expression reflects disease activity in ANCA-associated vasculitis and glomerulonephritis.
23378728 2013 S100 A and B expression in normal and inflamed human limbus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23320892 2013 Myeloid marker S100A8/A9 and lymphocyte marker, soluble interleukin 2 receptor: biomarkers of hidradenitis suppurativa disease activity?
23299480 2013 MRP8/14 enhances corneal susceptibility to Pseudomonas aeruginosa Infection by amplifying inflammatory responses.
23248262 2013 Increased myeloid-derived suppressor cells in gastric cancer correlate with cancer stage and plasma S100A8/A9 proinflammatory proteins.
23165982 2013 Involvement of Nrf2 activation in the upregulation of S100A9 by exposure to inorganic arsenite.
23018243 2012 Identification of S100A8 and S100A9 as negative regulators for lymph node metastasis of gastric adenocarcinoma.
22808130 2012 Molecular interface of S100A8 with cytochrome b558 and NADPH oxidase activation.
22806545 2013 Different expression of S100A8 in malignant and benign gallbladder diseases.
22728165 2012 Prostaglandin E2 stimulates S100A8 expression by activating protein kinase A and CCAAT/enhancer-binding-protein-beta in prostate cancer cells.
22683330 2012 S100A8 and S100A9 are messengers in the crosstalk between epidermis and dermis modulating a psoriatic milieu in human skin.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22660800 2012 Serum S100A8/A9, but not follistatin-like protein 1 and interleukin 18, may be a useful biomarker of disease activity in adult-onset Still's disease.
22634002 2012 The role of myofibroblasts in upregulation of S100A8 and S100A9 and the differentiation of myeloid cells in the colorectal cancer microenvironment.
22622474 2012 Elevated levels of proliferating and recently migrated tumor-associated macrophages confer increased aggressiveness and worse outcomes in breast cancer.
22555971 2012 Fecal calprotectin and alpha-1 antitrypsin predict severity and response to corticosteroids in gastrointestinal graft-versus-host disease.
22505354 2012 Hypoxia and HIF-1 increase S100A8 and S100A9 expression in prostate cancer.
22489132 2012 Pro-inflammatory S100A8 and S100A9 proteins: self-assembly into multifunctional native and amyloid complexes.
22446997 2012 Diagnostic evaluation of the MRP-8/14 for the emergency assessment of chest pain.
22420238 2011 Faecal calprotectin in the diagnosis of inflammatory bowel disease.
22381691 2012 A role for MRP8 in in stent restenosis in diabetes.
22363402 2012 Constitutive neutrophil apoptosis: regulation by cell concentration via S100 A8/9 and the MEK-ERK pathway.
22318783 2012 S100A8/A9 aggravates post-ischemic heart failure through activation of RAGE-dependent NF-?B signaling.
22282267 2012 Elevated S100A8/S100A9 expression causes glucocorticoid resistance in MLL-rearranged infant acute lymphoblastic leukemia.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22209981 2012 Double-stranded RNA induces S100 gene expression by a cycloheximide-sensitive factor.
22139384 2012 miR-24 functions as a tumor suppressor in Hep2 laryngeal carcinoma cells partly through down-regulation of the S100A8 protein.
22127564 2012 Alarmins S100A8 and S100A9 elicit a catabolic effect in human osteoarthritic chondrocytes that is dependent on Toll-like receptor 4.
22095980 2012 S100A8 and S100A9 in cardiovascular biology and disease.
21961943 Increased expression of S100 calcium binding protein A8 in GM-CSF-stimulated neutrophils leads to the increased expressions of IL-8 and IL-16.
21912088 2012 S100A8 and S100A9: new insights into their roles in malignancy.
21799753 2011 The tissue microlocalisation and cellular expression of CD163, VEGF, HLA-DR, iNOS, and MRP 8/14 is correlated to clinical outcome in NSCLC.
21791097 2011 Decreases in serum levels of S100A8/9 (calprotectin) correlate with improvements in total swollen joint count in patients with recent-onset rheumatoid arthritis.
21766173 2012 The role of serum myeloid-related protein 8/14 complex in Henoch-Schönlein purpura nephritis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21592353 2011 Increased serum myeloid-related protein 8/14 level is associated with atherosclerosis in type 2 diabetic patients.
21492422 2011 Protein synthesis of the pro-inflammatory S100A8/A9 complex in plasmacytoid dendritic cells and cell surface S100A8/A9 on leukocyte subpopulations in systemic lupus erythematosus.
21487906 2012 Dynamic mobility of immunological cells expressing S100A8 and S100A9 in vivo: a variety of functional roles of the two proteins as regulators in acute inflammatory reaction.
21472666 2011 RAGE-dependent regulation of calcium-binding proteins S100A8 and S100A9 in human THP-1.
21463326 2011 Analysis of plasma calprotectin and polymorphisms of S100A8 in patients with aggressive periodontitis.
21434523 2010 S100A8 cellular distribution in normal epithelium, hyperplasia, dysplasia and squamous cell carcinoma and its concentration in serum.
21334078 2012 S100A8/A9 complex as a new biomarker in prediction of mortality in elderly patients with severe heart failure.
21269460 2011 Initial characterization of the human central proteome.
21239714 2011 An essential role of STIM1, Orai1, and S100A8-A9 proteins for Ca2+ signaling and Fc?R-mediated phagosomal oxidative activity.
21228116 2011 S100A8/A9 activate key genes and pathways in colon tumor progression.
21192933 2011 Expression of S100A8/A9 in HaCaT keratinocytes alters the rate of cell proliferation and differentiation.
21072048 2011 Expression of S100A8 in leukemic cells predicts poor survival in de novo AML patients.
21067798 2011 Prothrombin haplotype associated with kidney stone disease in Northeastern Thai patients.
20936779 2010 A human MAP kinase interactome.
20833513 2010 Proteomic expression analysis of mycosis fungoides (MF) skin tissues: overexpressions of SOD2, S100A8 and FABP5 in MF.
20819668 2010 Up-regulation of the expression of S100A8 and S100A9 in lung adenocarcinoma and its correlation with inflammation and other clinical features.
20717964 2011 Altered intracellular calcium fluxes in pancreatic cancer induced diabetes mellitus: Relevance of the S100A8 N-terminal peptide (NT-S100A8).
20594128 2010 Clinical utility of calprotectin and lactoferrin as markers of inflammation in patients with inflammatory bowel disease.
20555353 2010 The antimicrobial heterodimer S100A8/S100A9 (calprotectin) is upregulated by bacterial flagellin in human epidermal keratinocytes.
20523765 2009 ANTI-INFECTIVE PROTECTIVE PROPERTIES OF S100 CALGRANULINS.
20219570 2010 iPLA2, a novel determinant in Ca2+- and phosphorylation-dependent S100A8/A9 regulated NOX2 activity.
20213444 2011 Inflammation-associated S100 proteins: new mechanisms that regulate function.
20172281 Evaluation of calprotectin level in intestinal content as an early marker for graft rejection.
20096140 2010 Identification of S100A8-correlated genes for prediction of disease progression in non-muscle invasive bladder cancer.
19957061 2010 S100A8/A9 induces apoptosis and inhibits metastasis of CasKi human cervical cancer cells.
19935772 2010 S100A8/A9 induces autophagy and apoptosis via ROS-mediated cross-talk between mitochondria and lysosomes that involves BNIP3.
19935766 2010 S100 Calgranulins in inflammatory arthritis.
19898558 2009 S100A8/A9: a mediator of severe asthma pathogenesis and morbidity?
19835859 2009 S100A8/A9: a Janus-faced molecule in cancer therapy and tumorgenesis.
19823685 2009 Calprotectin--a novel marker of obesity.
19755614 2009 Phagocyte-specific S100A8/A9 protein levels during disease exacerbations and infections in systemic lupus erythematosus.
19752232 2009 Bacterial surface protein L binds and inactivates neutrophil proteins S100A8/A9.
19695969 2010 Diagnostic value of faecal calprotectin in unselected outpatients referred for colonoscopy: A multicenter prospective study.
19670424 2009 S100A8 and S100A9 are novel nuclear factor kappa B target genes during malignant progression of murine and human liver carcinogenesis.
19608587 2010 Myeloid-related protein 8/14 levels in children with obstructive sleep apnoea.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
19530996 2009 Damage-associated molecular patterns--emerging targets for biologic therapy of childhood arthritides.
19466434 2009 Changes in S100A8 expression in UV-irradiated and aged human skin in vivo.
19451397 2009 The endogenous Toll-like receptor 4 agonist S100A8/S100A9 (calprotectin) as innate amplifier of infection, autoimmunity, and cancer.
19440546 2009 Amyloid formation by the pro-inflammatory S100A8/A9 proteins in the ageing prostate.
19284577 2009 Serum levels of soluble receptor for advanced glycation end products and of S100 proteins are associated with inflammatory, autoantibody, and classical risk markers of joint and vascular damage in rheumatoid arthritis.
19248102 2009 The myeloid-related proteins 8 and 14 complex, a novel ligand of toll-like receptor 4, and interleukin-1beta form a positive feedback mechanism in systemic-onset juvenile idiopathic arthritis.
19232095 2009 Myeloid-related protein 8/14 complex describes microcirculatory alterations in patients with type 2 diabetes and nephropathy.
19210342 2009 Family-based association analysis of S100A8 genetic polymorphisms with aggressive periodontitis.
19201880 2009 IL-10-dependent S100A8 gene induction in monocytes/macrophages by double-stranded RNA.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19186948 2009 Identification of S100A8 and S100A9 as serological markers for colorectal cancer.
19122197 2009 Calprotectin S100A9 calcium-binding loops I and II are essential for keratinocyte resistance to bacterial invasion.
19087201 2009 Substitution of methionine 63 or 83 in S100A9 and cysteine 42 in S100A8 abrogate the antifungal activities of S100A8/A9: potential role for oxidative regulation.
19079333 2009 Subversion of antimicrobial calprotectin (S100A8/S100A9 complex) in the cytoplasm of TR146 epithelial cells after invasion by Listeria monocytogenes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18922970 2008 Global gene expression profiling unveils S100A8/A9 as candidate markers in H-ras-mediated human breast epithelial cell invasion.
18832721 2008 S-nitrosylated S100A8: novel anti-inflammatory properties.
18786929 2008 Interaction between S100A8/A9 and annexin A6 is involved in the calcium-induced cell surface exposition of S100A8/A9.
18689872 2008 RAGE, carboxylated glycans and S100A8/A9 play essential roles in colitis-associated carcinogenesis.
18588753 Epithelial genes in chronic rhinosinusitis with and without nasal polyps.
18537548 2008 S100A8 and S100A9 overexpression is associated with poor pathological parameters in invasive ductal carcinoma of the breast.
18374411 2008 Seven placental transcripts characterize HELLP-syndrome.
18339893 2008 S100A8/A9 at low concentration promotes tumor cell growth via RAGE ligation and MAP kinase-dependent pathway.
18060880 2008 S100A8/9 induces cell death via a novel, RAGE-independent pathway that involves selective release of Smac/DIABLO and Omi/HtrA2.
18044712 2008 S100A8/A9, a key mediator for positive feedback growth stimulation of normal human keratinocytes.
18030206 2007 Fecal calprotectin: a quantitative marker of colonic inflammation in children with inflammatory bowel disease.
17936757 2007 The hetero-oligomeric complex of the S100A8/S100A9 protein is extremely protease resistant.
17895549 2007 Enhanced expression of myeloid-related protein complex (MRP8/14) in macrophages and multinucleated giant cells in granulomas of patients with active cardiac sarcoidosis.
17852869 2007 Serum and mucosal S100 proteins, calprotectin (S100A8/S100A9) and S100A12, are elevated at diagnosis in children with inflammatory bowel disease.
17787039 2007 S100 proteins calprotectin and S100A12 are related to radiographic changes rather than disease activity in psoriatic arthritis with low disease activity.
17644317 2007 Complex regulation of S100A8 by IL-17, dexamethasone, IL-4 and IL-13 in HaCat cells (human keratinocyte cell line).
17636430 2007 S100A8/S100A9 and their association with cartilage and bone.
17557234 2007 Novel partners of S100A8 identified in laryngeal cancer cell lines.
17553524 2007 The crystal structure of the human (S100A8/S100A9)2 heterotetramer, calprotectin, illustrates how conformational changes of interacting alpha-helices can determine specific association of two EF-hand proteins.
17469085 2007 The expression of S100A8 in pancreatic cancer-associated monocytes is associated with the Smad4 status of pancreatic cancer cells.
17429438 2007 HaCaT keratinocytes overexpressing the S100 proteins S100A8 and S100A9 show increased NADPH oxidase and NF-kappaB activities.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17197440 2007 A novel regulator of telomerase. S100A8 mediates differentiation-dependent and calcium-induced inhibition of telomerase activity in the human epidermal keratinocyte line HaCaT.
17090475 2006 Up-regulation of S100A8 and S100A9 protein in bronchial epithelial cells by lipopolysaccharide.
17069562 2007 Correlation between single nucleotide polymorphisms in a calprotectin subunit gene and risk of periodontitis in a Chinese population.
17050004 2006 Biophysical characterization of S100A8 and S100A9 in the absence and presence of bivalent cations.
16979015 2006 Expression of myeloid-related protein-8 and -14 in patients with acute Kawasaki disease.
16806487 2006 Myeloid-related protein-8/14 is associated with proinflammatory cytokines in cervical mucus.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16690079 2006 Calcium-dependent tetramer formation of S100A8 and S100A9 is essential for biological activity.
16613612 2006 The S100A8/A9 heterodimer amplifies proinflammatory cytokine production by macrophages via activation of nuclear factor kappa B and p38 mitogen-activated protein kinase in rheumatoid arthritis.
16573830 2006 Increased proinflammatory endothelial response to S100A8/A9 after preactivation through advanced glycation end products.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16297907 2006 S100A8 and S100A9 activate MAP kinase and NF-kappaB signaling pathways and trigger translocation of RAGE in human prostate cancer cells.
16258195 2005 Regulation of S100A8/A9 (calprotectin) binding to tumor cells by zinc ion and its implication for apoptosis-inducing activity.
16216873 2005 S100A8 and S100A9 in human arterial wall. Implications for atherogenesis.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16033829 2005 Calcium-binding proteins S100A8 and S100A9 as novel diagnostic markers in human prostate cancer.
15816004 2005 A strategy for high-resolution protein identification in surface-enhanced laser desorption/ionization mass spectrometry: calgranulin A and chaperonin 10 as protein markers for endometrial carcinoma.
15642721 2005 The arachidonic acid-binding protein S100A8/A9 promotes NADPH oxidase activation by interaction with p67phox and Rac-2.
15598812 2005 Myeloid-related proteins 8 and 14 induce a specific inflammatory response in human microvascular endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15331440 2004 MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes.
15069705 2004 Loss of myeloid-related proteins 8 and myeloid-related proteins 14 expression in human esophageal squamous cell carcinoma correlates with poor differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13130482 2003 Expression of myeloid-related proteins 8 and 14 in systemic-onset juvenile rheumatoid arthritis.
12937135 2003 Expression of calcium-binding proteins MRP8 and MRP14 in inflammatory muscle diseases.
12833525 2003 Mapping of proteins in human saliva using two-dimensional gel electrophoresis and peptide mass fingerprinting.
12748257 2003 S100A6 protein expression is different in Spitz nevi and melanomas.
12719414 2003 Changing the conformation state of cytochrome b558 initiates NADPH oxidase activation: MRP8/MRP14 regulation.
12710851 2003 Antimicrobial peptides in amniotic fluid: defensins, calprotectin and bacterial/permeability-increasing protein in patients with microbial invasion of the amniotic cavity, intra-amniotic inflammation, preterm labor and premature rupture of membranes.
12704215 2003 S100 protein subcellular localization during epidermal differentiation and psoriasis.
12697438 2003 Phagocyte-specific S100 proteins: a novel group of proinflammatory molecules.
12645005 2003 S100A9/S100A8: Myeloid representatives of the S100 protein family as prominent players in innate immunity.
12626582 2003 Proinflammatory activities of S100: proteins S100A8, S100A9, and S100A8/A9 induce neutrophil chemotaxis and adhesion.
12553726 2002 Evidence for the involvement of the unique C-tail of S100A9 in the binding of arachidonic acid to the heterocomplex S100A8/A9.
12489193 2002 S100A8 and S100A9 calcium-binding proteins: localization within normal and cyclosporin A-induced overgrowth gingiva.
12480428 2002 Hyperzincaemia and hypercalprotectinaemia: a new disorder of zinc metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218151 2002 HIV-1 transcription and virus production are both accentuated by the proinflammatory myeloid-related proteins in human CD4+ T lymphocytes.
12137245 2002 Implication of extracellular zinc exclusion by recombinant human calprotectin (MRP8 and MRP14) from target cells in its apoptosis-inducing activity.
11867565 2002 S100A8, S100A9 and the S100A8/A9 heterodimer complex specifically bind to human endothelial cells: identification and characterization of ligands for the myeloid-related proteins S100A9 and S100A8/A9 on human dermal microvascular endothelial cell line-1 cells.
11708798 2001 The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes.
11564187 2001 Selective expression of calcium-binding proteins S100a8 and S100a9 at distinct sites of hair follicles.
11435486 2001 Dimeric S100A8 in human neutrophils is diminished after phagocytosis.
11141076 2001 Interaction of S100A8/S100A9-arachidonic acid complexes with the scavenger receptor CD36 may facilitate fatty acid uptake by endothelial cells.
11058579 2000 Transendothelial migration of 27E10+ human monocytes.
10837826 2000 S100 proteins in Corpora amylacea from normal human brain.
10771424 2000 The structure of human MRP8, a member of the S100 calcium-binding protein family, by MAD phasing at 1.9 A resolution.
10571075 1999 Zinc binding reverses the calcium-induced arachidonic acid-binding capacity of the S100A8/A9 protein complex.
9920411 1998 Novel insights into structure and function of MRP8 (S100A8) and MRP14 (S100A9).
9867828 1999 Analysis of the MRP8-MRP14 protein-protein interaction by the two-hybrid system suggests a prominent role of the C-terminal domain of S100 proteins in dimer formation.
9083090 1997 Myeloid-related protein (MRP) 8 and MRP14, calcium-binding proteins of the S100 family, are secreted by activated monocytes via a novel, tubulin-dependent pathway.
8701470 1996 The S100 family of EF-hand calcium-binding proteins: functions and pathology.
8619876 1996 Host-parasite interaction in human onchocerciasis: identification and sequence analysis of a novel human calgranulin.
8423249 1993 In vitro antimicrobial activity of the human neutrophil cytosolic S-100 protein complex, calprotectin, against Capnocytophaga sputigena.
8400238 1993 MRP8 and MRP14, S-100-like proteins associated with myeloid differentiation, are translocated to plasma membrane and intermediate filaments in a calcium-dependent manner.
8341667 1993 Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E.
7849642 1994 Calprotectin-like protein is related to soluble organic matrix in calcium oxalate urinary stone.
7759097 1995 Isolation of a YAC clone covering a cluster of nine S100 genes on human chromosome 1q21: rationale for a new nomenclature of the S100 calcium-binding protein family.
7695842 1994 Isolation of an ascitic oncodevelopmental protein exhibiting high sequence homology with calcium-binding protein MRP8.
3561500 1987 A clue to the basic defect in cystic fibrosis from cloning the CF antigen gene.
3405210 1988 Cloning and expression of two human genes encoding calcium-binding proteins that are regulated during myeloid differentiation.
3313057 1987 Two calcium-binding proteins in infiltrate macrophages of rheumatoid arthritis.
3267695 1988 Expression pattern of two related cystic fibrosis-associated calcium-binding proteins in normal and abnormal tissues.
2149559 1990 Related calcium-binding proteins map to the same subregion of chromosome 1q and to an extended region of synteny on mouse chromosome 3.
2039599 1991 The calcium-binding protein MRP-8 is produced by human pulmonary tumor cells.
1326551 1992 Translocation of a small cytosolic calcium-binding protein (MRP-8) to plasma membrane correlates with human neutrophil activation.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.