Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.38
PubTator Score 14.15

Knowledge Summary


No data available


  Disease (2)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
psoriasis 6694 6.3e-94
Atopic dermatitis 952 5.3e-04
medulloblastoma, large-cell 6241 2.0e-03
cystic fibrosis 1696 4.4e-03


  Differential Expression (4)

Disease log2 FC p
psoriasis 7.200 6.3e-94
Atopic dermatitis 3.200 5.3e-04
cystic fibrosis 1.200 4.4e-03
medulloblastoma, large-cell 1.200 2.0e-03

Gene RIF (6)

AA Sequence

DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ                                            71 - 101

Text Mined References (13)

PMID Year Title