Property Summary

NCBI Gene PubMed Count 125
PubMed Score 208.43
PubTator Score 147.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 6.800 2.6e-208

Gene RIF (91)

AA Sequence

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI      1 - 70
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ                                            71 - 101
//

Text Mined References (127)

PMID Year Title