Property Summary

NCBI Gene PubMed Count 111
PubMed Score 190.40
PubTator Score 147.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 6.800 2.6e-208

Gene RIF (79)

PMID Text
26173840 rs3014837 polymorphism associated with calcium level in serum of psoriasis patients
26053695 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation of squamous cell carcinomas.
25651379 overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14
25622979 The distinct modulations of the NF-kappaB - miR-29b - p53 pathway make S100A7 an oncogene.
25572331 found that RAGE/S100A7 conditioned the tumor microenvironment by driving the recruitment of MMP9-positive tumor-associated macrophages
25550886 Our present results suggest that S100A7 level is a promising tool for diagnosis of lung squamous cell carcinoma. Knockdown of S100A7 suppresses lung cancer growth
25514480 decreased expression in nasal epithelia of allergic rhinitis patients
25502330 The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts
25256120 present a novel signalling mechanism by which IL-17A can induce Egr-1-dependent psoriasin expression via the ERK pathway in keratinocytes
24842328 The antimicrobial peptide psoriasin has immunoregulatory activities and is involved in skin innate immunity.
24671027 S100A7 also promotes secretion of IL-6 and IL-8.
24152708 The presence of S100A7 in the Fallopian tube and its localization at the apical surface of epithelial cells
24122701 S100A7 overexpression is associated with high risk of malignant transformation in oral dysplasia.
23618129 High S100A7 enhances invasion of breast cancer through activation of nuclear factor-kappaB signaling.
23614747 Levels of psoriasin, RNase 7 and hBD-3 expression - assessed by immunohistochemistry - varied between different body localisations.
23535840 S100A7 enhances metastasis in estrogen receptor alpha-negative breast cancer cells through regulation of actin cytoskeleton and MMP-9 secretion.
23499548 visfatin enhances CAMP, hBD-2, hBD-3, and S100A7 production in human keratinocytes and their orthologs in murine imiquimod-treated psoriatic skin.
23300877 expression of psoriasin is linked to the luminal differentiation marker CD24 in mammary epithelial cells. Psoriasin had a role in the shift towards a differentiated CD24(+) phenotype, suggesting a role in the differentiation of mammary epithelial cells.
23285311 Increased S100A7 expression was associated with trachomatous conjunctival scarring and may be linked to the pathophysiology of recurrent trachomatous trichiasis.
23228205 Psoriasin plays crucial roles in regulating the growth and invasion of lung cancer cells.
23151615 Psoriasin is a novel biomarker for, and the first to confirm the link between obesity and psoriasis.
22901663 Letter: Report IL-36-mediated psoriasin and LL-37 production in keratinocytes via MAPK/NFkappaaB pathway.
22795619 Psoriasin (S100A7) promotes migration of a squamous carcinoma cell line
22772316 Expression of psoriasin appears to be reduced in CFBE410-negative cells compared to 16HBE14o- cells; its expression treatment-wise is modified by exposure to pro-inflammatory cytokines.
22694938 Data indicate that aberrant expression of psoriasin is implicated in prostate cancer (CaP).
22641350 Each S100A7 isoform is involved in critical phases of the breast cancer growth and progression
22230654 The study showed an epithelial expression and excretion of S100A7 in the nose after microbial stimulation. The levels were diminished in rhinitis patients and in the presence of an allergic cytokine milieu.
22220760 report the presence of S100A7 in human sperm and of a homologous protein in pig, with similar localisations
22189627 psoriasin expression in mammary epithelial cells leads to increased endothelial cell proliferation in a paracrine manner through the receptor for advanced glycation end products.
22158945 Data show that hS100A7 and mS100a7a15 overexpression induce proliferation and expression of inflammatory cytokines/chemokines.
22126777 Psoriasin may play a role in the pathogenesis of mycosis fungoides by stimulating chemotaxis of CD4+ T lymphocytes.
22016394 Tumor-suppressive effects of psoriasin (S100A7) are mediated through the beta-catenin/T cell factor 4 protein pathway in estrogen receptor-positive breast cancer cells.
21740085 In comparison with the healthy gingiva, the expression of Doc-1 was decreased, whereas the expression of S100A7 was upregulated in all oral lesions.
21730203 found a significantly higher expression of the beta-defensins hBD-1 (P = .03), hBD-2 (P < 0.01), and hBD-3 (P < .001), and psoriasin (P = .001) in condylomata acuminata, compared with normal controls
21551409 psoriasin is produced by the structures of the ocular surface and is part of the innate immune system at the ocular surface and tear film.
21501383 Recent studies point to an important role of psoriasin as an antimicrobial and immunomodulatory protein in skin and other epithelia.
21324122 S100A7/psoriasin is found to be upregulated and enhances the epithelial barrier function of the lower respiratory tract upon microbial challenge especially in presence of S aureus.
21283546 rhamnolipids enable the induction of the antimicrobial protein psoriasin by flagellin in human skin without direct contact of bacteria and responding cells.
21187770 Changes in the expression pattern of S100A7 seem to be involved in the development of gingival irritation fibromas, whereas chronic inflammation might be of less importance.
21132011 These data identify a novel interaction between Psor and beta6 and demonstrate that it is required for alphavbeta6-dependent invasion by carcinoma cells.
20727496 The combination of an increased expression of the antimicrobial peptide DEFA-4, the oncogene S100-A7, epidermal growth factor, and tenascin-c, and a decreased Doc-1 expression in oral leukoplakia might characterize its potency of malignant transformation.
20689826 nuclear accumulation of S100A7 may serve as predictor of poor prognosis in HNSCC patients
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20571488 contributes to the innate immune response of the female genital tract
20226301 S100A7 showed significantly decreased expression in patients with chronic rhinosinusitis
20217214 Down-regulation of ICAM-1 in mammary epithelial cells may contribute both to the high expression of psoriasin seen in some high-grade ductal carcinoma in situ and to the induction of MUC1.
20101226 Inflammatory cytokines oncostatin-M and interleukin-6 can regulate S100A7 expression and that S100A7 may mediate some of their effects in breast cancer.
19844956 Presented is a detailed structural characterization of a triple mutant form of S100A73 lacking the ability to bind Jab1.
19810752 data suggest a complex interaction between S100A7 and the much larger Jab1. These studies form the basis for the development of small molecule reporters and modifiers of S100A7 form and function
19707901 mRNA levels in cholesteatoma significantly higher than in normal external auditory canal skin
19601998 Observational study of gene-disease association. (HuGE Navigator)
19249126 Psoriasin is overexpressed in epidermal keratinocytes in the epidermis of acne inversa lesions.
19162067 Psoriasin exerts pore-forming activity at pH values below 6 demonstrating that disruption of microbial membranes is the basis of its antimicrobial activity at low pH.
19159013 S100A7 may have a role in Alzheimer's disease
19079183 Psoriasin(S100A7) may be the key to the resistance of the human tongue toward E. coli.
18754038 the antimicrobial protein psoriasin (S100A7) is upregulated in atopic dermatitis and after experimental skin barrier disruption
18634149 A psoriasin assay might be considered as a rapid, noninvasive, useful salivary biomarker for the detection of pulmonary involvement in systemic sclerosis.
18625016 The results suggest a role for S100A7 in recurrent tonsillitis and allergic disease.
18606705 study defines RAGE (receptor for advanced glycation end products) as the hS100A7 receptor, whereas hS100A15 functions through a Gi protein-coupled receptor; hS100A7-RAGE binding, signaling, and chemotaxis are zinc-dependent in vitro
18588753 Expression of S100A7 and S100A8 was significantly decreased in CRS with and without nasal polyps when compared with controls.
18373864 Suggest S100A7 polymorphisms are associated with allergic rhinitis in Swedish population.
18373864 Observational study of gene-disease association. (HuGE Navigator)
18320059 Overexpression of S100A7 is associated with breast cancer
18263703 bacterial flagellin is essential and sufficient for the induction of S100A7c expression in keratinocytes by E. coli.
18223693 the pathway including S100A7/psoriasin and beta-catenin signaling has a role in tumor progression of squamous cell carcinoma of oral cavity
17986321 psoriasin expression is transcriptionally suppressed by IFN-gamma; this effect is likely to be mediated by the activation of the STAT1 signaling pathway
17560571 These results are consistent with a role for S100A7 in modulating the immune response which may be a factor in early breast tumor progression.
17418446 S100A7 was identified and validated as being associated with lung squamous cell carcinoma metastasis to the brain.
17159909 Central region of S100A7, including only amino acids 35-80, is sufficient for full antibacterial activity. Reduced S100A7 association with bacteria is associated with reduced antibacterial activity.
17136347 the up-regulation of psoriasin might play a role in the progression of skin cancer. The expression of psoriasin in human skin tumours seems to be independent from differentiation and inflammation.
17033192 Increased Psoriasin expression is associated with acne pathogenesis.
16675044 segment from -1513 to -988 contains up-regulatory elements for the transcription activity of the S100A7 gene in oral squamous cell carcinoma cell
16357139 Over-expression of psoriasin is associated with breast tumor progression
16236163 Psoriasin is a potent chemotactic factor and its down-regulation during inflammation might be of importance for the outcome of the disease.
15740587 Correlated with degree of differentiation. Absent in undifferentiated basalioma and strongly expressed in carcinoma in situ, keratoacanthoma, and differentiated squamous cell carcinoma. Expressed in superficial, differentiated region of normal epithelium.
15717926 These results support the hypothesis that the mouse S100A7 gene is structurally and functionally similar to human S100A7 and may offer a relevant model system for studying its normal biological function and putative role in tumor progression.
15615860 Psoriasin present in the amniotic fluid might have consequential immunobiological effects during the fetal development.
15201992 Aberrant expression of psoriasin is commonly seen in human breast cancer and excessively high levels are correlated with the clinical outcomes.
12839573 S100A7 expression appears to stabilize epidermal fatty acid binding protein level in keratinocytes

AA Sequence

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI      1 - 70
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ                                            71 - 101
//

Text Mined References (113)

PMID Year Title
26173840 2015 Association of S100A7 gene polymorphisms with manifestations of common types of psoriasis: effect on serum calcium levels.
26053695 2015 The Characteristics and Function of S100A7 Induction in Squamous Cell Carcinoma: Heterogeneity, Promotion of Cell Proliferation and Suppression of Differentiation.
25651379 2015 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation through GATA-3/caspase-14 pathway in A431 cells.
25622979 2015 miR-29b defines the pro-/anti-proliferative effects of S100A7 in breast cancer.
25572331 2015 RAGE mediates S100A7-induced breast cancer growth and metastasis by modulating the tumor microenvironment.
25550886 2014 Knockdown of S100A7 reduces lung squamous cell carcinoma cell growth in vitro and in vivo.
25514480 Th2 cytokines differentially regulate psoriasin expression in human nasal epithelia.
25502330 2015 The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts.
25256120 2014 Egr-1 is a key regulator of IL-17A-induced psoriasin upregulation in psoriasis.
24842328 2014 The antimicrobial protein S100A7/psoriasin enhances the expression of keratinocyte differentiation markers and strengthens the skin's tight junction barrier.
24671027 2014 Overexpression of S100A7 protects LPS-induced mitochondrial dysfunction and stimulates IL-6 and IL-8 in HaCaT cells.
24152708 2015 S100A7 in the Fallopian tube: a comparative study.
24122701 2014 S100A7 overexpression is a predictive marker for high risk of malignant transformation in oral dysplasia.
23618129 2013 S100A7 enhances invasion of human breast cancer MDA-MB-468 cells through activation of nuclear factor-?B signaling.
23614747 2013 Differential expression and in vivo secretion of the antimicrobial peptides psoriasin (S100A7), RNase 7, human beta-defensin-2 and -3 in healthy human skin.
23535840 2013 Differential role of psoriasin (S100A7) in estrogen receptor ? positive and negative breast cancer cells occur through actin remodeling.
23499548 2013 Visfatin enhances the production of cathelicidin antimicrobial peptide, human ?-defensin-2, human ?-defensin-3, and S100A7 in human keratinocytes and their orthologs in murine imiquimod-induced psoriatic skin.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300877 2012 The expression of Psoriasin (S100A7) and CD24 is linked and related to the differentiation of mammary epithelial cells.
23285311 2012 Post-operative recurrent trachomatous trichiasis is associated with increased conjunctival expression of S100A7 (psoriasin).
23228205 2012 The clinical significance of Psoriasin for non-small cell lung cancer patients and its biological impact on lung cancer cell functions.
23151615 2013 Psoriasin: a novel marker linked obesity with psoriasis.
22901663 2012 Interleukin-36 cytokines enhance the production of host defense peptides psoriasin and LL-37 by human keratinocytes through activation of MAPKs and NF-?B.
22795619 2012 Psoriasin (S100A7) promotes migration of a squamous carcinoma cell line.
22772316 2012 Reduced expression of psoriasin in human airway cystic fibrosis epithelia.
22694938 2013 Psoriasin (S100A7) is a positive regulator of survival and invasion of prostate cancer cells.
22641350 2012 Differential occurrence of S100A7 in breast cancer tissues: a proteomic-based investigation.
22230654 2012 Diminished levels of nasal S100A7 (psoriasin) in seasonal allergic rhinitis: an effect mediated by Th2 cytokines.
22220760 2012 S100A7 is present in human sperm and a homologous pig sperm protein interacts with sperm-binding glycoprotein (SBG).
22189627 2012 Psoriasin (S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote endothelial cell proliferation.
22158945 2012 S100A7 enhances mammary tumorigenesis through upregulation of inflammatory pathways.
22126777 2011 [Expression of psoriasin in mycosis fungoides and its significance].
22016394 2011 Tumor-suppressive effects of psoriasin (S100A7) are mediated through the ?-catenin/T cell factor 4 protein pathway in estrogen receptor-positive breast cancer cells.
21740085 2011 Risk estimation for a malignant transformation of oral lesions by S100A7 and Doc-1 gene expression.
21730203 2011 Induction of human ?-defensins and psoriasin in vulvovaginal human papillomavirus-associated lesions.
21551409 2011 Expression and regulation of antimicrobial peptide psoriasin (S100A7) at the ocular surface and in the lacrimal apparatus.
21501383 2011 Psoriasin: key molecule of the cutaneous barrier?
21324122 2011 S100A7/psoriasin expression in the human lung: unchanged in patients with COPD, but upregulated upon positive S. aureus detection.
21283546 2011 Flagellin delivery by Pseudomonas aeruginosa rhamnolipids induces the antimicrobial protein psoriasin in human skin.
21269460 2011 Initial characterization of the human central proteome.
21187770 2011 High ?-defensin and S100A7 expression and missing DOC-1 down-regulation characterize irritation fibromas of the oral cavity and may counteract malignant transformation.
21132011 2011 Psoriasin (S100A7) associates with integrin ?6 subunit and is required for ?v?6-dependent carcinoma cell invasion.
20727496 2010 Gene expression of oncogenes, antimicrobial peptides, and cytokines in the development of oral leukoplakia.
20689826 2010 Nuclear S100A7 is associated with poor prognosis in head and neck cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20571488 2010 Psoriasin (S100A7) is a major Escherichia coli-cidal factor of the female genital tract.
20226301 2010 Evidence for diminished levels of epithelial psoriasin and calprotectin in chronic rhinosinusitis.
20217214 2011 Loss of ICAM-1 signaling induces psoriasin (S100A7) and MUC1 in mammary epithelial cells.
20101226 2010 S100A7 (psoriasin) is induced by the proinflammatory cytokines oncostatin-M and interleukin-6 in human breast cancer.
19844956 2009 Structural and functional characterization of a triple mutant form of S100A7 defective for Jab1 binding.
19810752 2009 Identification and characterization of binding sites on S100A7, a participant in cancer and inflammation pathways.
19707901 2009 Psoriasin (S100A7), an antimicrobial peptide, is increased in human middle ear cholesteatoma.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
19249126 2009 Human beta-defensin-2 and psoriasin are overexpressed in lesions of acne inversa.
19162067 2009 The human antimicrobial protein psoriasin acts by permeabilization of bacterial membranes.
19159013 2009 S100A7, a novel Alzheimer's disease biomarker with non-amyloidogenic alpha-secretase activity acts via selective promotion of ADAM-10.
19079183 2008 Psoriasin (S100A7) is a principal antimicrobial peptide of the human tongue.
18754038 2009 The antimicrobial protein psoriasin (S100A7) is upregulated in atopic dermatitis and after experimental skin barrier disruption.
18634149 2008 Association of psoriasin (S100A7) with clinical manifestations of systemic sclerosis: is its presence in whole saliva a potential predictor of pulmonary involvement?
18625016 2008 Differentiated S100A7 expression in infected tonsils and tonsils from allergic individuals.
18606705 2008 Chemotactic activity of S100A7 (Psoriasin) is mediated by the receptor for advanced glycation end products and potentiates inflammation with highly homologous but functionally distinct S100A15.
18588753 Epithelial genes in chronic rhinosinusitis with and without nasal polyps.
18373864 2008 Comprehensive evaluation of genetic variation in S100A7 suggests an association with the occurrence of allergic rhinitis.
18320059 2008 S100A7-downregulation inhibits epidermal growth factor-induced signaling in breast cancer cells and blocks osteoclast formation.
18263703 2008 Flagellin is the principal inducer of the antimicrobial peptide S100A7c (psoriasin) in human epidermal keratinocytes exposed to Escherichia coli.
18223693 2008 Reciprocal negative regulation between S100A7/psoriasin and beta-catenin signaling plays an important role in tumor progression of squamous cell carcinoma of oral cavity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17986321 2007 S100A7 (Psoriasin), highly expressed in ductal carcinoma in situ (DCIS), is regulated by IFN-gamma in mammary epithelial cells.
17625598 2007 S100A15, an antimicrobial protein of the skin: regulation by E. coli through Toll-like receptor 4.
17560571 2007 S100A7 (psoriasin) influences immune response genes in human breast cancer.
17418446 2007 Identification and validation of S100A7 associated with lung squamous cell carcinoma metastasis to brain.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17159909 2007 S100A7 (Psoriasin)--mechanism of antibacterial action in wounds.
17136347 2007 Psoriasin (S100A7) is significantly up-regulated in human epithelial skin tumours.
17033192 2006 Psoriasin and follicular hyperkeratinization in acne comedones.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16675044 Transcription promoter activity of the human S100A7 gene in oral squamous cell carcinoma cell lines.
16357139 2005 A putative role for psoriasin in breast tumor progression.
16236163 2005 Psoriasin, one of several new proteins identified in nasal lavage fluid from allergic and non-allergic individuals using 2-dimensional gel electrophoresis and mass spectrometry.
16082188 2005 Psoriasin (S100A7) and calgranulin-B (S100A9) induction is dependent on reactive oxygen species and is downregulated by Bcl-2 and antioxidants.
15740587 2005 Expression patterns of S100A7 (psoriasin) and S100A9 (calgranulin-B) in keratinocyte differentiation.
15717926 2005 Expression analysis of the mouse S100A7/psoriasin gene in skin inflammation and mammary tumorigenesis.
15615860 2005 Psoriasin, a calcium-binding protein with chemotactic properties is present in the third trimester amniotic fluid.
15568027 2005 Antimicrobial psoriasin (S100A7) protects human skin from Escherichia coli infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217497 2004 S100A7 (psoriasin) expression is associated with aggressive features and alteration of Jab1 in ductal carcinoma in situ of the breast.
15201992 2004 Psoriasin is aberrantly expressed in human breast cancer and is related to clinical outcomes.
12923069 2003 Molecular cloning and characterization of alternatively spliced mRNA isoforms from psoriatic skin encoding a novel member of the S100 family.
12839573 2003 S100A7 (psoriasin) interacts with epidermal fatty acid binding protein and localizes in focal adhesion-like structures in cultured keratinocytes.
12704215 2003 S100 protein subcellular localization during epidermal differentiation and psoriasis.
12702588 2003 Psoriasin interacts with Jab1 and influences breast cancer progression.
12664160 2003 Genomic and phylogenetic analysis of the S100A7 (Psoriasin) gene duplications within the region of the S100 gene cluster on human chromosome 1q21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421467 2002 RanBPM interacts with psoriasin in vitro and their expression correlates with specific clinical features in vivo in breast cancer.
12032852 2002 The TRC8 hereditary kidney cancer gene suppresses growth and functions with VHL in a common pathway.
11782356 2002 Psoriasin expression in mammary epithelial cells in vitro and in vivo.
11258932 2001 S100A7, S100A10, and S100A11 are transglutaminase substrates.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10595935 1999 Psoriasin (S100A7) expression and invasive breast cancer.
10331666 1999 Probable interaction between S100A7 and E-FABP in the cytosol of human keratinocytes from psoriatic scales.
10191275 1999 Calcium-binding protein S100A7 and epidermal-type fatty acid-binding protein are associated in the cytosol of human keratinocytes.
10190323 1999 Genomic structure, promoter characterisation and mutational analysis of the S100A7 gene: exclusion of a candidate for familial psoriasis susceptibility.
10026247 1999 Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
9693957 1998 Psoriasin (S100A7).
9562557 1998 EF-hands at atomic resolution: the structure of human psoriasin (S100A7) solved by MAD phasing.
8701470 1996 The S100 family of EF-hand calcium-binding proteins: functions and pathology.
8618345 1996 Bladder squamous cell carcinomas express psoriasin and externalize it to the urine.
8618016 1996 Assignment of psoriasin to human chromosomal band 1q21: coordinate overexpression of clustered genes in psoriasis.
8526920 1995 Amino acid sequence analysis of human S100A7 (psoriasin) by tandem mass spectrometry.
8077703 1994 Psoriasin binds calcium and is upregulated by calcium to levels that resemble those observed in normal skin.
7759097 1995 Isolation of a YAC clone covering a cluster of nine S100 genes on human chromosome 1q21: rationale for a new nomenclature of the S100 calcium-binding protein family.
1940442 1991 Molecular cloning, occurrence, and expression of a novel partially secreted protein "psoriasin" that is highly up-regulated in psoriatic skin.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.