Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.26
PubTator Score 25.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.4e-12
lung adenocarcinoma 2714 6.6e-12
lung carcinoma 2844 2.1e-10
cystic fibrosis 1670 3.9e-05
lung cancer 4473 8.3e-05
Disease Target Count Z-score Confidence
Pilomatrixoma 11 3.341 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.208 3.9e-05
non-small cell lung cancer -1.347 5.4e-12
lung cancer 3.200 8.3e-05
lung adenocarcinoma -1.200 6.6e-12
lung carcinoma -1.300 2.1e-10

Gene RIF (7)

PMID Text
21377473 One disulfide bridge is between Cys30 in the N-terminal pseudo-EF-hand and Cys68 in the C-terminal EF-hand (SS1), and another disulfide bridge attaches Cys99 in the C-terminal coil structure to Cys81 in helix IV (SS2).
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19601998 Observational study of gene-disease association. (HuGE Navigator)
18083705 cytoplasmic S100A3 within the cuticular layer is mostly co-localized with the type III isoform of peptidylarginine deiminase (PAD3)
12470658 Purification and characterization of the S100A3 protein from human hair cuticles.
12136135 structure was solved by MIRAS phasing
12045193 crystal structure of S100A3 at 1.7-A resolution

AA Sequence

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV      1 - 70
DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ                                            71 - 101
//

Text Mined References (21)

PMID Year Title
21377473 2011 Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
18083705 2008 Specific citrullination causes assembly of a globular S100A3 homotetramer: a putative Ca2+ modulator matures human hair cuticle.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470658 2002 Characterization of the cysteine-rich calcium-binding S100A3 protein from human hair cuticles.
12136135 2002 Metal-free MIRAS phasing: structure of apo-S100A3.
12045193 2002 The crystal structure of metal-free human EF-hand protein S100A3 at 1.7-A resolution.
10837826 2000 S100 proteins in Corpora amylacea from normal human brain.
9920417 1998 Probing the structure of the human Ca2+- and Zn2+-binding protein S100A3: spectroscopic investigations of its transition metal ion complexes, and three-dimensional structural model.
9920416 1998 Clustered organization of S100 genes in human and mouse.
9468301 1998 A model for target protein binding to calcium-activated S100 dimers.
9274623 1997 Immunohistochemical localization of the Ca2+ binding S100 proteins in normal human skin and melanocytic lesions.
8701470 1996 The S100 family of EF-hand calcium-binding proteins: functions and pathology.
8672544 1996 Highly-expressed S100A3, a calcium-binding protein, in human hair cuticle.
8341667 1993 Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E.
7759097 1995 Isolation of a YAC clone covering a cluster of nine S100 genes on human chromosome 1q21: rationale for a new nomenclature of the S100 calcium-binding protein family.
7673133 1995 Purification and cation binding properties of the recombinant human S100 calcium-binding protein A3, an EF-hand motif protein with high affinity for zinc.