Property Summary

NCBI Gene PubMed Count 20
PubMed Score 2.30
PubTator Score 7.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
glioblastoma 1.300 4.9e-02
cystic fibrosis 1.092 6.3e-05
Duchenne muscular dystrophy 1.005 7.7e-09
adrenocortical carcinoma -1.624 8.3e-07
primary pancreatic ductal adenocarcinoma 1.647 1.9e-02
pancreatic cancer 1.600 1.7e-07
atypical teratoid/rhabdoid tumor -1.100 4.8e-04
group 3 medulloblastoma -1.400 2.3e-04
pilocytic astrocytoma 1.400 9.1e-09
posterior fossa group A ependymoma 1.100 2.3e-09
subependymal giant cell astrocytoma 1.306 1.1e-02
lung carcinoma -1.700 3.2e-16
mucosa-associated lymphoid tissue lympho... 1.160 3.1e-02
ductal carcinoma in situ 1.400 1.0e-02
ovarian cancer 1.200 3.3e-04
pituitary cancer -1.200 8.6e-05
psoriasis 1.100 2.0e-58

 GO Process (1)

Gene RIF (4)

PMID Text
26353754 These results indicate that S100 calcium binding protein A16 is a differentiation promoting protein and might function as a tumor suppressor in oral squamous cell carcinoma.
25884418 Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion
25287362 S100A16 had a potential function to regulate some embryonic transcription factors to promote epithelial-mensenchymal transition in breast cancer cells which may be an important target site for the therapy of breast cancer.
21046186 The presence of hydrophobic interactions stronger than for other S100 proteins, present in the closed form of S100A16 between the third and fourth helices, likely make the closed structure of the second EF-hand particularly stable.

AA Sequence

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH      1 - 70
DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS                                          71 - 103
//

Text Mined References (23)

PMID Year Title
26353754 2015 S100A16 promotes differentiation and contributes to a less aggressive tumor phenotype in oral squamous cell carcinoma.
25884418 2015 Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion.
25416956 2014 A proteome-scale map of the human interactome network.
25287362 2014 Up-regulation of S100A16 expression promotes epithelial-mesenchymal transition via Notch1 pathway in breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21046186 2011 Structural characterization of human S100A16, a low-affinity calcium binder.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17030513 2006 S100A16, a novel calcium-binding protein of the EF-hand superfamily.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684152 2004 S100A16, a ubiquitously expressed EF-hand protein which is up-regulated in tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.
8781769 1996 Searching for NIDDM susceptibility genes: studies of genes with triplet repeats expressed in skeletal muscle.