Property Summary

NCBI Gene PubMed Count 34
PubMed Score 22.80
PubTator Score 23.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (17)

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN      1 - 70
LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH                                         71 - 104
//

Text Mined References (35)

PMID Year Title