Property Summary

NCBI Gene PubMed Count 35
PubMed Score 29.74
PubTator Score 30.87

Knowledge Summary

Patent

No data available

Expression

PDB (12)

Gene RIF (14)

AA Sequence

MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE      1 - 70
LKFNEYWRLIGELAKEIRKKKDLKIRKK                                               71 - 98
//

Text Mined References (36)

PMID Year Title