Property Summary

NCBI Gene PubMed Count 34
PubMed Score 28.84
PubTator Score 30.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
27008379 This is the first report for the association between HMGA1 and S100A13 expression in the modulation of thyroid cancer growth and invasion.
24982031 S100A13 interacts with the C2 domain of RAGE.
24722184 S100A13 is involved in cutaneous malignant melanoma resistance to DTIC/TMZ.
21270123 the IL1alpha-S100A13 tetrameric complex is the key complex formed during the non-classical pathway of IL1alpha release
20863990 S100A13 promotes the release of FGF-1 protein, but does not affect the transportation of FGF-1 protein in human umbilical vein endothelial cells.
20208480 S100A13 is expressed in melanocytic lesions when the angiogenic switch occurs and it may cooperate with VEGF-A in supporting the formation of new blood vessels, favoring the shift from radial to vertical tumor growth.
18259052 Despite the high similarity of the backbone conformation in each protomer, the crystal structures of human S100A13 at pH 7.5 and at pH 6.0 exhibit recognizable differences in the relative orientation of the protomers within the dimer
17374362 S100A13 is a homodimer with four EF-hand motifs in an asymmetric unit, displaying a folding pattern similar to other S100 members. S100A13 has the unique structural feature with all alpha-helices being amphiphilic.
17077500 Human S100A13 was heterologously expressed in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method.
16773219 In human astrocytic gliomas, S100A13 was significantly up-regulated in high-grade vascularized gliomas. Moreover, S100A13 expression significantly correlated with microvessel density and tumour grading.
15821778 data show that the expression of endoglin and S100A13 protein corresponds to the activation of the endothelial cells in the process of endometriotic angiogenesis
15033494 S100A13 protein translocation in response to extracellular S100 is mediated by receptor for advanced glycation endproducts in human endothelial cells
12746488 Stress-induced export of IL-1alpha involves the intracellular association with the Cu2+-binding protein, S100A13; the expression of a S100A13 mutant functions as a dominant-negative repressor of IL-1alpha release.
12645008 detected in both cells and fibers of the hippocampus at 12 weeks gestation, slightly stronger at 20 weeks, and then decreased with age. In the temporal cortex, strong in all cellular layers at 12 to 24 weeks, declined with age from 28 weeks onwards.

AA Sequence

MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE      1 - 70
LKFNEYWRLIGELAKEIRKKKDLKIRKK                                               71 - 98
//

Text Mined References (35)

PMID Year Title
27008379 2016 The association between S100A13 and HMGA1 in the modulation of thyroid cancer proliferation and invasion.
25416956 2014 A proteome-scale map of the human interactome network.
24982031 2014 Interaction of S100A13 with C2 domain of receptor for advanced glycation end products (RAGE).
24722184 2014 Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21270123 2011 The IL1alpha-S100A13 heterotetrameric complex structure: a component in the non-classical pathway for interleukin 1alpha secretion.
21269460 2011 Initial characterization of the human central proteome.
20863990 2010 Effect of human S100A13 gene silencing on FGF-1 transportation in human endothelial cells.
20208480 2010 S100A13 is a new angiogenic marker in human melanoma.
19284995 2009 S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
18259052 2008 Structure of calcium-bound human S100A13 at pH 7.5 at 1.8 A resolution.
17374362 2007 Crystal structure study on human S100A13 at 2.0 A resolution.
17077500 2006 Crystallization and preliminary X-ray analysis of human S100A13.
16773219 2006 S100A13, a new marker of angiogenesis in human astrocytic gliomas.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16145699 2005 Structural interplay between calcium(II) and copper(II) binding to S100A13 protein.
15821778 2005 Endoglin (cd105) and S100A13 as markers of active angiogenesis in endometriosis.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033494 2004 S100 protein translocation in response to extracellular S100 is mediated by receptor for advanced glycation endproducts in human endothelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12746488 2003 S100A13 mediates the copper-dependent stress-induced release of IL-1alpha from both human U937 and murine NIH 3T3 cells.
12645008 2003 Differential expression of S100 proteins in the developing human hippocampus and temporal cortex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135982 2002 The intracellular translocation of the components of the fibroblast growth factor 1 release complex precedes their assembly prior to export.
12118070 2002 S100A13 and S100A6 exhibit distinct translocation pathways in endothelial cells.
11432880 2001 Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress.
10722710 2000 S100A13. Biochemical characterization and subcellular localization in different cell lines.
10051426 1999 Three distinct anti-allergic drugs, amlexanox, cromolyn and tranilast, bind to S100A12 and S100A13 of the S100 protein family.
9712836 1998 S100A13 is involved in the regulation of fibroblast growth factor-1 and p40 synaptotagmin-1 release in vitro.
8985590 1996 Characterization of the human S100A12 (calgranulin C, p6, CAAF1, CGRP) gene, a new member of the S100 gene cluster on chromosome 1q21.
8878558 1996 Characterization of the human and mouse cDNAs coding for S100A13, a new member of the S100 protein family.
7759097 1995 Isolation of a YAC clone covering a cluster of nine S100 genes on human chromosome 1q21: rationale for a new nomenclature of the S100 calcium-binding protein family.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.