Property Summary

NCBI Gene PubMed Count 90
PubMed Score 180.61
PubTator Score 935.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Synonym

Accession P60903 A8K4V8 P08206 Q5T1C5
Symbols 42C
P11
p10
GP11
ANX2L
CAL1L
CLP11
Ca[1]
ANX2LG

Gene

PDB

4DRW   4FTG   4HRG   1A4P   1BT6   4HRE   4HRH  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (59)

PMID Text
26925708 annexin A2 and S100A10 expressions are powerful predictors of serous ovarian cancer outcome.
26465153 These data show that disruption of ANX2/p11 interaction results in reduced ALL cell adhesion to osteoblasts, increased ALL cell sensitization to chemotherapy, and suppression of ALL cell homing and engraftment.
25428414 TPH1 gene polymorphisms and S100A10 expression, which correlate with 5-HT signaling were associated with ramosetron effectiveness in IBS-D, and may possibly lead to prospective identification of the resistance to treatment.
25303710 Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation
23994525 an annexin A2-S100A10 molecular bridge participates in cell-cell interactions, revealing a hitherto unexplored function of this protein interaction
23931152 Authors show here that AnxA2, p11 and AHNAK are required for type 3 secretion system-mediated Salmonella invasion of cultured epithelial cells.
23828264 Data suggest a role for S100A10 as a prognostic marker and potential therapeutic target in colorectal cancer.
23757730 complex formation of AnxA2 with S100A10 is a central regulatory mechanism in the acute release of VWF in response to cAMP-elevating agonists
23696646 extracellular C-1-P, acting through the extracellular annexin a2-p11 heterotetrameric protein, can mediate vascular endothelial cell invasion.
23637395 Annexin A2 and S100A10 regulate human papillomavirus type 16 entry and intracellular trafficking in human keratinocytes.
23598417 Overexpression of miR-590-5P reduced the activity of luciferase expressed by a vector bearing the 3' untranslated region of S100A10 mRNA. Ectopic miR-590-5P overexpression mediated by lentiviral infection decreased expression of S100A10.
23595865 Suggest annexin A10 as potential marker of sessile serrated adenoma/polyps.
23275167 Binding of AHNAK to the surface of AnxA2 is governed by several hydrophobic interactions between side chains of AHNAK and pockets on S100A10.
23129259 results demonstrate the crucial role of S100A10 in actin dynamics promoting cell spreading via Rac1 activation
23091277 N-terminal acetylation of AnxA2 is required for S100A10 binding
22940583 The AHNAK peptide adopts a coil conformation that arches across the heterotetramer contacting both annexin A2 and S100A10 protomers with tight affinity.
22927980 annexin A2 heterotetramer contributes to HPV16 internalization and infection of epithelial cells and this interaction is dependent on the presence of the L2 minor capsid protein
22830395 Annexin A2 anchors S100A10 to the cell surface and, in doing so, allows S100A10 to play a prominent role in the activation of plasminogen in angiogenesis and oncogenesis.
22797859 Human chondrocytes with downregulated S100A10 showed significantly decreased production of inflammatory cytokines such as tumor necrosis factor-alpha, IL-1beta and IL-10; hence, S100A10 might be considered a potential target for anti-inflammatory treatment
22365974 COX7A2, TAGLN2 and S100-A10 as novel prognostic markers in Barrett's adenocarcinoma.
21938494 the overexpression of thioredoxin,S100-A10 and S100-A6 specifically distinguished metastatic from non-metastatic tumors.
21928315 Interferon-gamma stimulates p11-dependent surface expression of annexin A2 in lung epithelial cells to enhance phagocytosis.
21849434 Both the annexin A2 and p11 subunits of calpactin I coimmunoprecipitate with human papillomavirus type 16 E5 in COS cells and in human epithelial cell lines, and an intact E5 C terminus is required for binding.
21722919 This study demonstrates that PBMC p11 mRNA expression is associated with neural activation in the brain of BD patients and warrants a larger translational study to determine its clinical utility.
21372205 DLC1 binding to S100A10 did not affect DLC1's RhoGAP activity, but it decreased the steady-state level of S100A10 expression.
21367534 Understanding the chromatin remodeling involved in the glucocorticoid-mediated increase of p11 expression by stress may clarify stress-induced over-expression of p
21310922 S100A10 plays a crucial role in the generation of plasmin leading to fibrinolysis, thus providing a link to the clinical hemorrhagic phenotype of acute promyelocytic leukemia
21269277 The present study represents a first attempt to systematically understand the molecular basis for the calcium-insensitive open conformation of S100A10.
20863517 The results of this study suggested that PBMC p11 mRNA levels may be a potential adjunctive biomarker for the assessment of suicide risk in mental disorders and warrants a larger translational study to determine its clinical utility.
20100475 First insights of S100A10 function as a regulator of the filamentous actin network.
20093721 CFTR function by annexin A2-S100A10 complex has roles in health and disease [review]
19730683 Observational study of gene-disease association. (HuGE Navigator)
19601998 Observational study of gene-disease association. (HuGE Navigator)
19521263 Expression of S100A10 (but not other S100 proteins investigated) varied in melanoma cell lines (i.e., S100A10 was down-regulated in 3 cell lines compared with normal melanocytes). Expression of S100A10 correlated with proliferation marker, Ki67.
18838110 Our findings suggest that p11 genetic variants do not play a major role in the MDD susceptibility, antidepressant therapeutic response or the risk of suicide attempt in MDD.
18838110 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18434302 Within the endothelial cell, p11 is required for Src kinase-mediated tyrosine phosphorylation of A2, which signals translocation of both proteins to the cell surface.
18288090 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17999956 the annexin II-S100A10 complex, which regulates exocytosis, forms a ternary complex with TrpRS.
17971878 p11/S100A10 light chain of annexin A2 is dispensable for annexin A2 association to endosomes and functions in endosomal transport
17824845 analysis of the pH-induced membrane binding of annexins A6 and A2-S100A10
17695432 S100A10 and annexin II contribute to the aggressive characteristics of anaplastic carcinoma, while playing a constitutive role in papillary carcinoma.
17581860 The anx 2-S100A10/CFTR complex is important for CFTR function across epithelia.
17510952 Observational study of gene-disease association. (HuGE Navigator)
17510952 Single nucleotide polymorphisms in S100A10 gene is not associated with major depressive disorder
17241856 p11 expression was increased in inflammatory bowel disease
16984913 that Annexin2 is required for strong binding of S100A10 to the C-terminal domain of the protein Ahnak.
16890384 It is proposed that p11 may act through the tPA/plasminogen/BDNF pathway to achieve its antidepressant effect.
16400147 results of the present study indicate that the dynamic modulation of 5-HT1B receptor function by p11 may be involved in molecular adaptations occurring in neuronal networks that are dysfunctional in depression-like states
16230353 analysis of the structural determinant of the PtdIns(4,5)P2 selectivity of A2t (annexin II-p11 heterotetramer), which may be involved in the regulation of PtdIns(4,5)P2 clustering in the cell
15849182 complex with annexin II is a substrate of thioredoxin
15574370 S100A10 and annexin A2 play an important role in plasmin regulation and in cancer cell invasiveness and metastasis [review]
15302870 Temperature stress-induced annexin 2 translocation is dependent on both expression of protein p11 tyrosine phosphorylation of annexin 2
13679511 annexin 2/S100A10 complex functions in the intracellular positioning of recycling endosomes and that both subunits are required for this activity
12730231 analysis of S100A10 interaction with tissue plasminogen activator, plasminogen, and plasmin
12645529 IFN-gamma-stimulated p11 expression may serve a counterregulatory role in human epithelial cells
12235365 Calpactin light chain binds to bluetongue virus NS3 protein
12198146 p11 interacts specifically with the TASK-1 K+ channel.
12163506 These results suggest that epidermal growth factor treatment increased p11 bound to cPLA(2) may lead to the late suppression of AA release induced by EGF.

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQ      1 - 70
SFFSLIAGLTIACNDYFVVHMKQKGKK                                                71 - 97
//

Text Mined References (95)

PMID Year Title
26925708 2016 Annexin A2 and S100A10 are independent predictors of serous ovarian cancer outcome.
26465153 2015 Disruption of Annexin II /p11 Interaction Suppresses Leukemia Cell Binding, Homing and Engraftment, and Sensitizes the Leukemia Cells to Chemotherapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25428414 2015 Pilot study of Biomarkers for predicting effectiveness of ramosetron in diarrhea-predominant irritable bowel syndrome: expression of S100A10 and polymorphisms of TPH1.
25303710 2015 Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation.
24457100 2014 Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23994525 2013 Protein interactions between surface annexin A2 and S100A10 mediate adhesion of breast cancer cells to microvascular endothelial cells.
23931152 2014 The Annexin A2/p11 complex is required for efficient invasion of Salmonella Typhimurium in epithelial cells.
23861394 2013 Lipid segregation and membrane budding induced by the peripheral membrane binding protein annexin A2.
23828264 2013 S100A10 as a novel biomarker in colorectal cancer.
23757730 2013 cAMP-induced secretion of endothelial von Willebrand factor is regulated by a phosphorylation/dephosphorylation switch in annexin A2.
23696646 2013 Ceramide 1-phosphate mediates endothelial cell invasion via the annexin a2-p11 heterotetrameric protein complex.
23637395 2013 Annexin A2 and S100A10 regulate human papillomavirus type 16 entry and intracellular trafficking in human keratinocytes.
23598417 2013 MiR-590-5P inhibits growth of HepG2 cells via decrease of S100A10 expression and Inhibition of the Wnt pathway.
23595865 2013 Gene expression profiling of serrated polyps identifies annexin A10 as a marker of a sessile serrated adenoma/polyp.
23415230 2013 SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275167 2013 Structure of a C-terminal AHNAK peptide in a 1:2:2 complex with S100A10 and an acetylated N-terminal peptide of annexin A2.
23129259 2013 S100A10 is required for the organization of actin stress fibers and promotion of cell spreading.
23091277 2012 N-terminal acetylation of annexin A2 is required for S100A10 binding.
22940583 2012 Structure of an asymmetric ternary protein complex provides insight for membrane interaction.
22927980 2012 The S100A10 subunit of the annexin A2 heterotetramer facilitates L2-mediated human papillomavirus infection.
22830395 2012 Regulation of plasmin generation by the annexin A2 heterotetramer: a shift in perspective.
22797859 2012 Regulation of inflammatory response in human chondrocytes by lentiviral mediated RNA interference against S100A10.
22365974 2012 MALDI imaging mass spectrometry reveals COX7A2, TAGLN2 and S100-A10 as novel prognostic markers in Barrett's adenocarcinoma.
21938494 2012 S100-A10, thioredoxin, and S100-A6 as biomarkers of papillary thyroid carcinoma with lymph node metastasis identified by MALDI imaging.
21928315 2012 Interferon-? stimulates p11-dependent surface expression of annexin A2 in lung epithelial cells to enhance phagocytosis.
21849434 2011 The human papillomavirus type 16 E5 oncoprotein translocates calpactin I to the perinuclear region.
21722919 2011 P11 expression and PET in bipolar disorders.
21372205 2011 DLC1 interaction with S100A10 mediates inhibition of in vitro cell invasion and tumorigenicity of lung cancer cells through a RhoGAP-independent mechanism.
21367534 2011 Glucocorticoid-induced p11 over-expression and chromatin remodeling: a novel molecular mechanism of traumatic stress?
21310922 2011 Regulation of S100A10 by the PML-RAR-? oncoprotein.
21269460 2011 Initial characterization of the human central proteome.
21269277 2011 Identification of regions responsible for the open conformation of S100A10 using chimaeric S100A11-S100A10 proteins.
20863517 2011 P11 (S100A10) as a potential biomarker of psychiatric patients at risk of suicide.
20100475 2010 Regulation of cellular actin architecture by S100A10.
20093721 2009 Regulation of CFTR function by annexin A2-S100A10 complex in health and disease.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
19521263 2009 Expression patterns of S100 proteins in melanocytes and melanocytic lesions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18838110 2008 Association study of p11 gene with major depressive disorder, suicidal behaviors and treatment response.
18434302 2008 Endothelial cell annexin A2 regulates polyubiquitination and degradation of its binding partner S100A10/p11.
18288090 2008 Pharmacogenetic analysis of genes implicated in rodent models of antidepressant response: association of TREK1 and treatment resistance in the STAR(*)D study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17999956 2008 Evidence for annexin II-S100A10 complex and plasmin in mobilization of cytokine activity of human TrpRS.
17971878 2007 The p11/S100A10 light chain of annexin A2 is dispensable for annexin A2 association to endosomes and functions in endosomal transport.
17824845 2008 Annexins sense changes in intracellular pH during hypoxia.
17695432 S100A10 expression in thyroid neoplasms originating from the follicular epithelium: contribution to the aggressive characteristic of anaplastic carcinoma.
17581860 2007 The formation of the cAMP/protein kinase A-dependent annexin 2-S100A10 complex with cystic fibrosis conductance regulator protein (CFTR) regulates CFTR channel function.
17510952 2007 Investigating the role of p11 (S100A10) sequence variation in susceptibility to major depression.
17241856 2007 Alterations in expression of p11 and SERT in mucosal biopsy specimens of patients with irritable bowel syndrome.
16984913 2006 Identification of an AHNAK binding motif specific for the Annexin2/S100A10 tetramer.
16890384 2007 The P11, tPA/plasminogen system and brain-derived neurotrophic factor: Implications for the pathogenesis of major depression and the therapeutic mechanism of antidepressants.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16400147 2006 Alterations in 5-HT1B receptor function by p11 in depression-like states.
16230353 2005 Phosphoinositide specificity of and mechanism of lipid domain formation by annexin A2-p11 heterotetramer.
15849182 2005 Annexin A2-S100A10 heterotetramer, a novel substrate of thioredoxin.
15574370 2005 S100A10, annexin A2, and annexin a2 heterotetramer as candidate plasminogen receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302870 2004 An annexin 2 phosphorylation switch mediates p11-dependent translocation of annexin 2 to the cell surface.
15196694 2004 Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699089 2004 AHNAK interaction with the annexin 2/S100A10 complex regulates cell membrane cytoarchitecture.
13679511 2003 The annexin 2/S100A10 complex controls the distribution of transferrin receptor-containing recycling endosomes.
12730231 2003 Phospholipid-associated annexin A2-S100A10 heterotetramer and its subunits: characterization of the interaction with tissue plasminogen activator, plasminogen, and plasmin.
12660155 2003 Functional expression of the epithelial Ca(2+) channels (TRPV5 and TRPV6) requires association of the S100A10-annexin 2 complex.
12645529 2003 Interferon-gamma induces p11 gene and protein expression in human epithelial cells through interferon-gamma-activated sequences in the p11 promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235365 2002 The membrane trafficking protein calpactin forms a complex with bluetongue virus protein NS3 and mediates virus release.
12198146 2002 p11, an annexin II subunit, an auxiliary protein associated with the background K+ channel, TASK-1.
12163506 2002 Epidermal growth factor induces p11 gene and protein expression and down-regulates calcium ionophore-induced arachidonic acid release in human epithelial cells.
11939791 2002 The p11 subunit of annexin II heterotetramer is regulated by basic carboxypeptidase.
11590242 2001 Control of the nuclear-cytoplasmic partitioning of annexin II by a nuclear export signal and by p11 binding.
11571284 2001 p11 expression in human bronchial epithelial cells is increased by nitric oxide in a cGMP-dependent pathway involving protein kinase G activation.
10777578 2000 Human procathepsin B interacts with the annexin II tetramer on the surface of tumor cells.
10559334 1999 Induction of endogenous genes following infection of human endothelial cells with an E1(-) E4(+) adenovirus gene transfer vector.
9886297 1999 The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
9369453 1997 Interference of BAD (Bcl-xL/Bcl-2-associated death promoter)-induced apoptosis in mammalian cells by 14-3-3 isoforms and P11.
9202034 1997 P11, a unique member of the S100 family of calcium-binding proteins, interacts with and inhibits the activity of the 85-kDa cytosolic phospholipase A2.
9047302 1997 Characterization of human recombinant annexin II tetramer purified from bacteria: role of N-terminal acetylation.
9036930 1997 Differential expression of the calpactin I subunits annexin II and p11 in cultured keratinocytes and during wound repair.
8898866 1996 Mapping of a regulatory important site for protein kinase C phosphorylation in the N-terminal domain of annexin II.
8701470 1996 The S100 family of EF-hand calcium-binding proteins: functions and pathology.
8341667 1993 Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E.
8276421 1993 Physical mapping of a functional cluster of epidermal differentiation genes on chromosome 1q21.
7821789 1994 Construction of a human full-length cDNA bank.
7759097 1995 Isolation of a YAC clone covering a cluster of nine S100 genes on human chromosome 1q21: rationale for a new nomenclature of the S100 calcium-binding protein family.
2148288 1990 Protein-protein recognition via short amphiphilic helices; a mutational analysis of the binding site of annexin II for p11.
1831433 1991 Primary structure of human, chicken, and Xenopus laevis p11, a cellular ligand of the Src-kinase substrate, annexin II.
1533380 1992 Cloning and characterization of the human gene encoding p11: structural similarity to other members of the S-100 gene family.
1533123 1992 Differential recognition of secretory vesicles by annexins. European Molecular Biology Organization Course "Advanced Techniques for Studying Secretion".
1386341 1992 cDNA sequence of human p11 calpactin I light chain.