Property Summary

NCBI Gene PubMed Count 96
PubMed Score 191.39
PubTator Score 935.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Borna disease 6 4.308 2.2
Cancer 2499 3.406 1.7

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma 1.900 1.2e-03
aldosterone-producing adenoma -1.789 2.4e-02
astrocytic glioma 2.100 1.1e-02
Astrocytoma, Pilocytic 2.800 1.1e-10
atypical teratoid/rhabdoid tumor 1.200 4.1e-02
Becker muscular dystrophy 1.476 6.6e-05
Breast cancer 1.200 1.0e-03
cystic fibrosis -1.266 7.6e-06
Duchenne muscular dystrophy 1.719 1.7e-10
ependymoma 2.400 1.8e-02
fibroadenoma -1.300 3.8e-02
gastric carcinoma 1.800 1.1e-02
glioblastoma 1.600 7.8e-04
intraductal papillary-mucinous neoplasm ... 1.500 3.8e-02
juvenile dermatomyositis 1.239 4.1e-09
limb girdle muscular dystrophy 2A 1.494 1.1e-07
lung cancer -2.900 8.6e-06
lung carcinoma -3.300 3.6e-38
medulloblastoma, large-cell -1.300 1.3e-03
mucosa-associated lymphoid tissue lympho... 1.450 1.1e-02
ovarian cancer -2.300 2.2e-07
pancreatic cancer 1.600 2.8e-06
pancreatic ductal adenocarcinoma liver m... 2.117 2.9e-02
Pick disease 1.300 2.5e-02
pituitary cancer -1.900 1.5e-03
subependymal giant cell astrocytoma 1.591 8.3e-03
X-linked recessive Emery-Dreifuss muscul... 1.094 1.0e-02

Gene RIF (63)

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQ      1 - 70
SFFSLIAGLTIACNDYFVVHMKQKGKK                                                71 - 97
//

Text Mined References (102)

PMID Year Title