Property Summary

NCBI Gene PubMed Count 100
PubMed Score 296.00
PubTator Score 928.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.600 4.1e-03
atypical teratoid / rhabdoid tumor -1.300 2.2e-02
dermatomyositis -2.300 8.9e-05
ependymoma -1.600 6.3e-03
glioblastoma -1.600 4.2e-05
group 3 medulloblastoma -2.900 2.5e-04
juvenile dermatomyositis -1.113 1.7e-06
medulloblastoma, large-cell -2.100 9.0e-05
oligodendroglioma -1.100 7.0e-09
ovarian cancer 1.200 1.2e-06
primitive neuroectodermal tumor -2.100 3.2e-05
psoriasis -1.400 9.4e-04

PDB (10)

Gene RIF (65)

AA Sequence

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEV      1 - 70
DFQEYVVLVAALTVACNNFFWENS                                                   71 - 94
//

Text Mined References (105)

PMID Year Title