Property Summary

NCBI Gene PubMed Count 26
PubMed Score 57.81
PubTator Score 27.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.408 2.0e-02
astrocytic glioma -2.000 1.3e-02
oligodendroglioma -1.500 3.6e-02
psoriasis 1.600 1.8e-04
osteosarcoma 2.156 2.3e-06
posterior fossa group B ependymoma -1.600 2.2e-12
glioblastoma -1.800 2.8e-06
atypical teratoid / rhabdoid tumor -1.500 3.7e-06
medulloblastoma, large-cell -1.100 4.1e-03
juvenile dermatomyositis 1.006 1.2e-11
acute quadriplegic myopathy 1.023 4.2e-07
tuberculosis -1.600 5.0e-06
primary pancreatic ductal adenocarcinoma 1.567 3.8e-02
lung cancer -1.400 1.2e-02
pediatric high grade glioma -1.500 1.4e-07
group 4 medulloblastoma 1.300 3.7e-04
pilocytic astrocytoma -1.400 3.1e-07
spina bifida -1.725 3.6e-02
Pick disease 1.200 1.1e-03
ovarian cancer 1.400 1.3e-03
pancreatic cancer 1.500 3.1e-02
dermatomyositis 1.200 6.7e-04

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26104682 Results identify a novel YY1 ~ miR-9 ~ RYBP axis involved in melanoma tumorigenesis and reinforce the idea that regulatory circuitries involving miRNAs and TFs are prevalent mechanisms.
25344099 RYBP has a role in survival of patients with hepatocellular carcinoma (HCC) and responsiveness to chemotherapy
22723975 Polymorphisms in RYBP and AOAH genes are associated with chronic rhinosinusitis in a Chinese population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19098711 RYBP interacts with MDM2 via residues 1-73 and 144-228 & decreases MDM2-mediated p53 ubiquitination, stabilizing p53 increasing its activity. RYBP is decreased in human cancer tissues.
18551146 Adenovirus expressing Rybp synergistically cooperates with the death receptor ligand, tumor necrosis factor-alpha, in the induction of apoptosis, and thus may have clinical applicability for the treatment of cancer.
14765135 DEDAF associates with a DED-containing DNA-binding protein in the nucleus and regulates the transcription activity [DEDAF human]
14691460 Apoptin is efficiently delivered and induced apoptosis in cancer cells when fused to the HIV-TAT protein transduction domain.
12411495 interacts specifically with the E2F2 and E2F3 family members, dependent on the marked box domain in these proteins
11953439 YEAF1/RYBP and YAF-2 are functionally distinct members of a cofactor family for the YY1 and E4TF1/hGABP transcription factors.

AA Sequence

MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY      1 - 70
ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSET     71 - 140
NHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGS    141 - 210
SRSSTPKGDMSAVNDESF                                                        211 - 228
//

Text Mined References (33)

PMID Year Title
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26104682 2015 YY1 regulates melanoma tumorigenesis through a miR-9?~?RYBP axis.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25344099 2014 RYBP expression is associated with better survival of patients with hepatocellular carcinoma (HCC) and responsiveness to chemotherapy of HCC cells in vitro and in vivo.
24855944 2014 The TRPM7 chanzyme is cleaved to release a chromatin-modifying kinase.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723975 2012 Polymorphisms in RYBP and AOAH genes are associated with chronic rhinosinusitis in a Chinese population: a replication study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20696397 2010 Polycomb group targeting through different binding partners of RING1B C-terminal domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19098711 2009 RYBP stabilizes p53 by modulating MDM2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18551146 2008 Adenoviral-mediated Rybp expression promotes tumor cell-specific apoptosis.
17070805 2006 The Polycomb-associated protein Rybp is a ubiquitin binding protein.
16943429 2006 Polycomb group and SCF ubiquitin ligases are found in a novel BCOR complex that is recruited to BCL6 targets.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14765135 2004 Human death effector domain-associated factor interacts with the viral apoptosis agonist Apoptin and exerts tumor-preferential cell killing.
14691460 2004 TAT-apoptin is efficiently delivered and induces apoptosis in cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411495 2002 Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function.
11953439 2002 YEAF1/RYBP and YAF-2 are functionally distinct members of a cofactor family for the YY1 and E4TF1/hGABP transcription factors.
11395500 2001 The death effector domain-associated factor plays distinct regulatory roles in the nucleus and cytoplasm.
11171983 2001 The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex.
10369680 1999 RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1.