Property Summary

NCBI Gene PubMed Count 70
PubMed Score 40.43
PubTator Score 30.65

Knowledge Summary

Patent (4,873)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 2.2e-68
non diabetic and post-ischemic heart fai... 1.100 8.0e-03
medulloblastoma, large-cell 1.400 2.8e-03
group 4 medulloblastoma 1.100 4.0e-02
lung carcinoma 1.300 4.4e-06
dermatomyositis -1.200 1.2e-02

Protein-protein Interaction (5)

Gene RIF (29)

PMID Text
26355550 Data show that pregnane X receptor/retinoid X receptor PXR/RXR-[alpha], RXR-[beta], or RXR-[gamma] expression was noted in 9 (16.4%), 9 (16.4%), and 10 (18.2%) pancreatic adenocarcinoma cases, respectively.
26148973 Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR.
23969901 Differences in RAR and RXR subtype mRNA expression patterns in various PTCs may contribute to the immunochemistry data available, and may thus find exploitation in clinical oncology, particularly in the differential diagnosis of thyroid neoplasms.
23936423 loss of RXR-gamma levels appears to provide mechanistic benefits to transformed cells towards the acquisition of resistance to apoptosis hallmark of cancer
23759678 Genetic variation in RXRgamma gene may contribute to the development of HIVLD in combination antiretroviral therapy treated HIV patients.
22180072 The RXR-gamma rs3818569 single nucleotide polymorphisms is associated with diabetic retinopathy development in the Taiwanese population.
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
21131950 results indicate that RXR-gamma is a positive regulator of endogenous oligodendrocyte precursor cell differentiation and remyelination.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20510503 RXRgamma and PPARgamma ligands acted synergistically to inhibit proliferation and invasiveness in colon cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20113835 methylation-associated downregulation of the RXRG gene may play a differential role in the carcinogenesis of non-small cell lung cancer (NSCLC) according to smoking status.
19754311 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19106195 These data indicate that the RAR/RXR heterodimer is a critical regulator of human hematopoietic stem cell (HSC) differentiation, and pharmacological modulation of RXR signaling prevents the loss of human HSCs that otherwise occurs in short-term culture.
19064610 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18398047 Observational study of gene-disease association. (HuGE Navigator)
18269685 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17272748 RXRgamma contributes to the genetic background of familial combined hyperlipidemia.
16197915 These results show that the stimulation of ASCT2 expression in response to glutamine in part involves binding of FXR/RXR to the ASCT2 promoter.
15635645 Observational study of gene-disease association. (HuGE Navigator)
15608692 The retinoid X receptor, gamma expression is mainly restricted to the muscle and brain.
15299084 Retinoid X receptor-gamma and peroxisome proliferator-activated receptor-gamma expression may have roles in apoptosis of thyroid carcinoma
15186611 Single nucleotide polymorphism not a factor in resistance to thyroid hormone.
12514092 RXRalpha and RXRgamma immunodetected in all normal, nodular, and basal cell hyperplasia, as well as carcinomatous prostates. In atrophic glands, the expression of both receptors was found in 22.5% of samples.

AA Sequence

MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPY      1 - 70
RVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICA     71 - 140
ICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQ    141 - 210
EERQRSRERAESEAECATSGHEDMPVERILEAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL    211 - 280
VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRV    281 - 350
LTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL    351 - 420
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT                               421 - 463
//

Text Mined References (70)

PMID Year Title
26355550 2015 Pregnane X Receptor Expression in Human Pancreatic Adenocarcinoma: Associations With Clinicopathologic Parameters, Tumor Proliferative Capacity, Patients' Survival, and Retinoid X Receptor Expression.
26148973 2015 Selective ligand activity at Nur/retinoid X receptor complexes revealed by dimer-specific bioluminescence resonance energy transfer-based sensors.
25416956 2014 A proteome-scale map of the human interactome network.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23969901 2013 mRNA expression pattern of retinoic acid and retinoid X nuclear receptor subtypes in human thyroid papillary carcinoma.
23936423 2013 Expression proteomics predicts loss of RXR-? during progression of epithelial ovarian cancer.
23759678 2013 RXR? gene variants are associated with HIV lipodystrophy.
22193333 2012 Adaptive evolution of the Retinoid X receptor in vertebrates.
22180072 2011 Association between retinoid-X receptor-gamma genetic polymorphisms and diabetic retinopathy.
22100394 2012 UG repeats/TDP-43 interactions near 5' splice sites exert unpredictable effects on splicing modulation.
22020178 2012 The retinoid X receptors and their ligands.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21843636 2011 Stable over-expression of PPAR?/? and PPAR? to examine receptor signaling in human HaCaT keratinocytes.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21368711 2011 Genome-wide association study of personality traits in bipolar patients.
21355951 2011 Retinoid X receptor ? up-regulation is correlated with dedifferentiation of tumor cells and lymph node metastasis in papillary thyroid carcinoma.
21187846 2011 An RXR-? Rx for white-matter damage.
21131950 2011 Retinoid X receptor gamma signaling accelerates CNS remyelination.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20510503 2010 RXRgamma and PPARgamma ligands in combination to inhibit proliferation and invasiveness in colon cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20113835 2010 Epigenetic inactivation of retinoid X receptor genes in non-small cell lung cancer and the relationship with clinicopathologic features.
20019805 2009 Meta-analysis of inter-species liver co-expression networks elucidates traits associated with common human diseases.
19754311 2009 Genomewide association study of a rapid progression cohort identifies new susceptibility alleles for AIDS (ANRS Genomewide Association Study 03).
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19106195 2009 Pharmacological manipulation of the RAR/RXR signaling pathway maintains the repopulating capacity of hematopoietic stem cells in culture.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18398047 2008 Single nucleotide polymorphisms in obesity-related genes and the risk of esophageal cancers.
18269685 2008 Type 2 diabetes susceptibility genes on chromosome 1q21-24.
17272748 2007 High frequency of a retinoid X receptor gamma gene variant in familial combined hyperlipidemia that associates with atherogenic dyslipidemia.
17195188 2007 Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16197915 2005 Identification of the promoter elements involved in the stimulation of ASCT2 expression by glutamine availability in HepG2 cells and the probable involvement of FXR/RXR dimers.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635645 2005 Structural variants in the retinoid receptor genes in patients with schizophrenia and other psychiatric diseases.
15608692 2004 Retinoid X receptors: X-ploring their (patho)physiological functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15299084 2004 Retinoid X receptor-gamma and peroxisome proliferator-activated receptor-gamma expression predicts thyroid carcinoma cell response to retinoid and thiazolidinedione treatment.
15186611 2004 Search for genetic variants in the retinoid X receptor-gamma-gene by polymerase chain reaction-single-strand conformation polymorphism in patients with resistance to thyroid hormone without mutations in thyroid hormone receptor beta gene.
12615696 2003 Activation of peroxisome proliferator-activated receptor gamma and retinoid X receptor results in net depletion of cellular cholesteryl esters in macrophages exposed to oxidized lipoproteins.
12514092 Immunohistochemical detection of the retinoid X receptors alpha, beta, and gamma in human prostate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444914 2002 Retinoid receptors in the developing human lung.
12361685 Expression of PPAR and RXR isoforms in the developing rat and human term placentas.
12082103 2002 The activation function-1 domain of Nur77/NR4A1 mediates trans-activation, cell specificity, and coactivator recruitment.
11839661 2002 The role of retinoid X receptor messenger RNA expression in curatively resected non-small cell lung cancer.
11641790 2001 Retinoid-dependent antagonism of serum response factor transactivation mediated by transcriptional coactivator proteins.
11397877 2001 Retinoid receptors in the human endometrium and its disorders: a possible modulator of 17 beta-hydroxysteroid dehydrogenase.
9794455 1998 The thyrotropin beta-subunit gene is repressed by thyroid hormone in a novel thyrotrope cell line, mouse T alphaT1 cells.
9150186 1997 Suppression of retinoic acid receptor beta in non-small-cell lung cancer in vivo: implications for lung cancer development.
9147069 1997 Expression of retinoid-X receptors (-alpha,-beta,-gamma) and retinoic acid receptors (-alpha,-beta,-gamma) in normal human skin: an immunohistological evaluation.
9143002 1997 Immunohistochemical expression of retinoid X receptor isoforms in human pituitaries and pituitary adenomas.
9006910 1997 Identification of a retinoid/chicken ovalbumin upstream promoter transcription factor response element in the human retinoid X receptor gamma2 gene promoter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8616895 1996 A CBP integrator complex mediates transcriptional activation and AP-1 inhibition by nuclear receptors.
8391126 1993 The mouse retinoid-X receptor-gamma gene: genomic organization and evidence for functional isoforms.
8127707 1994 Activation of myoD gene transcription by 3,5,3'-triiodo-L-thyronine: a direct role for the thyroid hormone and retinoid X receptors.
8034312 1994 Chromosomal localization of the human retinoid X receptors.
7806300 1995 Physical mapping of the retinoid X receptor B gene in mouse and human.
1312497 1992 Characterization of three RXR genes that mediate the action of 9-cis retinoic acid.
1310259 1992 Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently.