Property Summary

Ligand Count 67
NCBI Gene PubMed Count 74
PubMed Score 42.05
PubTator Score 30.65

Knowledge Summary

Patent (4,873)

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis -1.200 1.2e-02
group 4 medulloblastoma 1.100 4.0e-02
lung carcinoma 1.300 4.4e-06
medulloblastoma, large-cell 1.400 2.8e-03
non diabetic and post-ischemic heart fai... 1.100 8.0e-03
psoriasis -1.100 2.5e-03

Protein-protein Interaction (4)

Gene RIF (31)

AA Sequence

MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPY      1 - 70
RVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICA     71 - 140
ICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQ    141 - 210
EERQRSRERAESEAECATSGHEDMPVERILEAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL    211 - 280
VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRV    281 - 350
LTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL    351 - 420
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT                               421 - 463
//

Text Mined References (74)

PMID Year Title