Property Summary

NCBI Gene PubMed Count 71
PubMed Score 49.67
PubTator Score 82.25

Knowledge Summary

Patent (4,592)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 1.9e-02
ependymoma 1.500 1.3e-02
oligodendroglioma 1.700 1.2e-03
osteosarcoma 1.696 3.2e-05
group 4 medulloblastoma 1.100 4.0e-02
subependymal giant cell astrocytoma -1.383 3.3e-02

Protein-protein Interaction (1)

Gene RIF (32)

PMID Text
26355550 Data show that pregnane X receptor/retinoid X receptor PXR/RXR-[alpha], RXR-[beta], or RXR-[gamma] expression was noted in 9 (16.4%), 9 (16.4%), and 10 (18.2%) pancreatic adenocarcinoma cases, respectively.
24183235 RXR interaction is necessary for NPM-RAR-mediated myeloid maturation arrest.
22322885 A fatty acid-binding protein 7/RXRbeta pathway enhances survival and proliferation in triple-negative breast cancer.
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888660 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19811264 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19255064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223982 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18375961 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18217139 PPARgamma/retinoid X receptor complex released from activated platelets in microparticles was internalized by a monocytic cell line.
17916375 In healthy elderly men reduction of RXRbeta expression in peripheral blood mononuclear cells might be a common feature of physiological senescence.
17389020 Observational study of gene-disease association. (HuGE Navigator)
17341859 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17341859 In the RXRB polymorphism, no genotype TT is observed in patients with psoriasis guttata with a positive personal history of repeated tonsillitis (p(corr) = 0.001).
15635645 Observational study of gene-disease association. (HuGE Navigator)
15608692 The retinoid X receptor, beta is expressed widely and can be found in almost every tissue.
14985366 partial dissociation of TR/retinoid X receptor heterodimer complex from the TRE is involved in the suppression of transcription induced by polychlorinated biphenyls
12514092 Diminished RXRbeta expression might be related to prostate cancer progression. Because responsiveness to retinoic acid treatments depends on expression of different receptors, it is important to study their expression before therapy.
12175732 Family studies revealed significant linkage disequilibrium between the RXRB alleles and a number of HLA-DPB1 alleles.
11840500 Observational study of gene-disease association. (HuGE Navigator)
11840500 polymorphism is unrelated to schizophrenia or alcoholism.
11839661 The role of retinoid X receptor messenger RNA expression in curatively resected non-small cell lung cancer

AA Sequence

MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGR      1 - 70
DGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSM     71 - 140
GSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGD    141 - 210
RSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQ    211 - 280
RGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTL    281 - 350
VEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV    351 - 420
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLL    421 - 490
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA                               491 - 533
//

Text Mined References (75)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26355550 2015 Pregnane X Receptor Expression in Human Pancreatic Adenocarcinoma: Associations With Clinicopathologic Parameters, Tumor Proliferative Capacity, Patients' Survival, and Retinoid X Receptor Expression.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24183235 2013 Interaction with RXR is necessary for NPM-RAR-induced myeloid differentiation blockade.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
22322885 2012 A fatty acid-binding protein 7/RXR? pathway enhances survival and proliferation in triple-negative breast cancer.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19888660 2009 Genetic determinants of serum lipid levels in Chinese subjects: a population-based study in Shanghai, China.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19811264 2009 Retinoid X receptor beta polymorphisms do not explain functional differences in vitamins D and A response in Antineutrophil cytoplasmic antibody associated vasculitis patients.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19255064 2009 Vitamin D-related genes, serum vitamin D concentrations and prostate cancer risk.
19223982 2009 Genetic variability of RXRB, PPARA, and PPARG in Wegener's granulomatosis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18375961 2008 Polymorphism of genes related to insulin sensitivity and the risk of biliary tract cancer and biliary stone: a population-based case-control study in Shanghai, China.
18217139 2008 Peroxisome proliferator-activated receptor gamma and retinoid X receptor transcription factors are released from activated human platelets and shed in microparticles.
17916375 Age-related change in the retinoid X receptor beta gene expression in peripheral blood mononuclear cells of healthy volunteers: effect of 13-cis retinoic acid supplementation.
17389020 2007 Sequence variation within the major histocompatibility complex subregion centromeric of HLA class II in type 1 diabetes.
17341859 2007 Three retinoid X receptor gene polymorphisms in plaque psoriasis and psoriasis guttata.
17195188 2007 Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635645 2005 Structural variants in the retinoid receptor genes in patients with schizophrenia and other psychiatric diseases.
15608692 2004 Retinoid X receptors: X-ploring their (patho)physiological functions.
15589691 2004 Cholesterol and cholesterol plus DHA diet-induced gene expression and fatty acid changes in mouse eye and brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207008 2004 Structure-function evolution of the transforming acidic coiled coil genes revealed by analysis of phylogenetically diverse organisms.
14985366 2004 Polychlorinated biphenyls suppress thyroid hormone receptor-mediated transcription through a novel mechanism.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12970175 2003 Crystal structure of the heterodimeric complex of LXRalpha and RXRbeta ligand-binding domains in a fully agonistic conformation.
12767074 2003 Growth inhibitory retinoid effects after recruitment of retinoid X receptor beta to the retinoic acid receptor beta promoter.
12549917 2003 Effects of retinoid ligands on RIP140: molecular interaction with retinoid receptors and biological activity.
12514092 Immunohistochemical detection of the retinoid X receptors alpha, beta, and gamma in human prostate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403842 2002 Real-time analysis of molecular interaction of retinoid receptors and receptor-interacting protein 140 (RIP140).
12175732 2002 Linkage disequilibrium between HLA-DPB1 alleles and retinoid X receptor beta haplotypes.
11840500 2002 Mutation analysis of the retinoid X receptor beta, nuclear-related receptor 1, and peroxisome proliferator-activated receptor alpha genes in schizophrenia and alcohol dependence: possible haplotype association of nuclear-related receptor 1 gene to alcohol dependence.
11839661 2002 The role of retinoid X receptor messenger RNA expression in curatively resected non-small cell lung cancer.
11782480 2002 The structural basis for the specificity of retinoid-X receptor-selective agonists: new insights into the role of helix H12.
11278635 2001 Ligand-dependent formation of retinoid receptors, receptor-interacting protein 140 (RIP140), and histone deacetylase complex is mediated by a novel receptor-interacting motif of RIP140.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10611353 1999 Retina-specific nuclear receptor: A potential regulator of cellular retinaldehyde-binding protein expressed in retinal pigment epithelium and Müller glial cells.
10594021 2000 The orphan nuclear receptor SHP inhibits hepatocyte nuclear factor 4 and retinoid X receptor transactivation: two mechanisms for repression.
10187832 1999 Identification of a novel DNA binding site for nuclear orphan receptor OR1.
9727070 1998 The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions.
9627117 1998 Characterization of Brx, a novel Dbl family member that modulates estrogen receptor action.
9267036 1997 Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.
9150186 1997 Suppression of retinoic acid receptor beta in non-small-cell lung cancer in vivo: implications for lung cancer development.
9013766 1997 RIP 140 enhances nuclear receptor-dependent transcription in vivo in yeast.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8670810 1996 Human TAF(II28) promotes transcriptional stimulation by activation function 2 of the retinoid X receptors.
8381386 1993 Cloning and chromosome mapping of human retinoid X receptor beta: selective amino acid sequence conservation of a nuclear hormone receptor in mammals.
8257090 1993 Mapping of RXRB to human chromosome 6p21.3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8034312 1994 Chromosomal localization of the human retinoid X receptors.
7990953 1994 An unusual member of the nuclear hormone receptor superfamily responsible for X-linked adrenal hypoplasia congenita.
7758108 1995 Unique response pathways are established by allosteric interactions among nuclear hormone receptors.
7705655 1995 A novel pathway for vitamin A signaling mediated by RXR heterodimerization with NGFI-B and NURR1.
7556191 1995 Involvement of retinoic acid receptor alpha in the stimulation of tissue-type plasminogen-activator gene expression in human endothelial cells.
7481822 1995 Sequence and characterization of a coactivator for the steroid hormone receptor superfamily.
1662118 1991 RXR beta: a coregulator that enhances binding of retinoic acid, thyroid hormone, and vitamin D receptors to their cognate response elements.
1514958 1992 The human cDNA sequence homologous to the mouse MHC class I promoter-binding protein gene contains four additional codons in lymphocytes.
1331778 1992 Heterodimerization among thyroid hormone receptor, retinoic acid receptor, retinoid X receptor, chicken ovalbumin upstream promoter transcription factor, and an endogenous liver protein.
1330328 1992 Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently.
1315958 1992 Isolation of a full-length cDNA clone encoding a N-terminally variant form of the human retinoid X receptor beta.
1310259 1992 Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently.