Property Summary

Ligand Count 205
NCBI Gene PubMed Count 304
PubMed Score 237.89
PubTator Score 1398.44

Knowledge Summary

Patent (8,536)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.900 1.4e-02
Chronic Lymphocytic Leukemia 1.169 2.8e-05
group 4 medulloblastoma -1.600 4.0e-05
interstitial cystitis -1.100 3.3e-04
invasive ductal carcinoma -1.300 1.7e-03
lung carcinoma -1.200 2.0e-15
medulloblastoma, large-cell -1.100 1.4e-02
mucosa-associated lymphoid tissue lympho... 1.010 1.9e-02
osteosarcoma -1.575 1.8e-03
ovarian cancer -1.600 3.4e-07
pancreatic ductal adenocarcinoma liver m... -1.171 3.7e-03
pituitary cancer -1.600 2.3e-08

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (79)

Gene RIF (183)

AA Sequence

MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISS      1 - 70
PMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGD     71 - 140
RSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ    141 - 210
RGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV    211 - 280
EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVL    281 - 350
TELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL    351 - 420
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT                                421 - 462
//

Text Mined References (322)

PMID Year Title