Property Summary

NCBI Gene PubMed Count 304
PubMed Score 237.89
PubTator Score 1398.44

Knowledge Summary

Patent (8,536)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.900 1.4e-02
Chronic Lymphocytic Leukemia 1.169 2.8e-05
group 4 medulloblastoma -1.600 4.0e-05
interstitial cystitis -1.100 3.3e-04
invasive ductal carcinoma -1.300 1.7e-03
lung carcinoma -1.200 2.0e-15
medulloblastoma, large-cell -1.100 1.4e-02
mucosa-associated lymphoid tissue lympho... 1.010 1.9e-02
osteosarcoma -1.575 1.8e-03
ovarian cancer -1.600 3.4e-07
pancreatic ductal adenocarcinoma liver m... -1.171 3.7e-03
pituitary cancer -1.600 2.3e-08

Synonym

Accession P19793 B3KY83 Q2NL52 Q2V504
Symbols NR2B1

Gene

PDB

3R29   3R2A   1XV9   1XVP   1FM6   1FM9   1K74   1RDT   3DZU   3DZY   3E00   3H0A   5JI0   1YNW   4J5W   4J5X   1DSZ   5UAN   2NLL   4ZO1   1MV9   1MVC   1MZN   2P1T   2P1U   2P1V   2ZXZ   2ZY0   3E94   3FUG   3KWY   3OAP   3OZJ   3PCU   3R5M   4K4J   4K6I   4M8E   4M8H   4NQA   4OC7   4POH   4POJ   4PP3   4PP5   4RFW   4RMC   4RMD   4RME   4ZSH   5EC9   5LYQ   5MK4   1BY4   1FBY   1G1U   1G5Y   1LBD   1R0N   1RXR   1XLS   2ACL   3FAL   3FC6   3NSP   3NSQ   3UVV   4CN2   4CN3   4CN5   4CN7   4N5G   4N8R   5GYM   5MJ5   5MKJ   5MKU   5MMW   5TBP  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (183)

AA Sequence

MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISS      1 - 70
PMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGD     71 - 140
RSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ    141 - 210
RGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV    211 - 280
EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVL    281 - 350
TELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL    351 - 420
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT                                421 - 462
//

Text Mined References (322)

PMID Year Title