Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.08
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.2e-06
medulloblastoma, large-cell 6241 3.4e-06
lung cancer 4740 1.1e-03
glioblastoma 5792 1.6e-03
Pick disease 1894 3.6e-03
active Crohn's disease 922 2.1e-02
Disease Target Count
Immunodeficiency 23 3

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.005 2.1e-02
glioblastoma -1.100 1.6e-03
lung cancer 1.800 1.1e-03
medulloblastoma, large-cell -1.700 3.4e-06
ovarian cancer -1.500 2.2e-06
Pick disease -1.100 3.6e-03

 Compartment GO Term (2)

AA Sequence

MSASVKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKI      1 - 70
DLQVTMPHSYPYVALQLFGRSSELDRHQQLLLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKL     71 - 140
VYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCMTGKPGIICVEGFKEHCEEFWHT    141 - 210
IRYPNWKHISCKHAESVETEGNGEDLRLFHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLKKHKSEHVFQ    211 - 280
ILFGIESKSSDS                                                              281 - 292
//

Text Mined References (7)

PMID Year Title