Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.87
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H446 A8K3W2 A8MT24 Q9Y313 Q9Y6B3
Symbols CGI-24
PTD013

Gene

PDB

2EBM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIF      1 - 70
SQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQL     71 - 140
FHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEV    141 - 210
DESLFQEMDDLELEDDEDDPDYNPADPESDSAD                                         211 - 243
//

Text Mined References (14)

PMID Year Title