Property Summary

NCBI Gene PubMed Count 87
PubMed Score 83.81
PubTator Score 76.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 3.3e-07
colon cancer 1475 9.5e-06
lung cancer 4473 6.2e-05
osteosarcoma 7933 8.4e-04
diabetes mellitus 1663 1.0e-03
Multiple myeloma 1327 2.1e-03
non primary Sjogren syndrome sicca 840 4.5e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.026 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.085 2.1e-03
osteosarcoma -1.199 8.4e-04
lung cancer 2.000 6.2e-05
colon cancer 1.600 9.5e-06
diabetes mellitus -1.500 1.0e-03
non primary Sjogren syndrome sicca 1.100 4.5e-02
ovarian cancer 2.300 3.3e-07

Gene RIF (46)

PMID Text
26863765 by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring
26303906 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26211835 The authors report that HIV-1 exploits the host factor RuvB-like 2 (RVB2) to balance relative expression of Gag and Env for efficient production of infectious virions.
26211835 HIV-1 Env antagonizes RUVBL2 by competitive interaction with HIV-1 MA
26211835 shRNA downregulation of RUVBL2 reduces the the infectivity of HIV-1 produced by HEK293T cells; RUVBL2 enhances HIV-1 infectivity
25957047 results reveal a novel mechanism for the control of NF-kappaB pathway by cytoplasmic Reptin
25875766 Data suggest that overexpression of Reptin in hepatocellular carcinoma (HCC) could be a factor of resistance to treatment.
25428364 The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex.
25336637 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
24990942 these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination.
24023044 Anti-RuvBL1/2 antibody is a novel systemic scleroderma-related autoantibody associated with a unique combination of clinical features, including myositis overlap and diffuse cutaneous involvement.
23891720 The Reptin is unable to bind with membrane-associated APPL proteins.
23878400 Data indicate that the RVB1/2 chromatin-remodeling complex is required for efficient Pol II recruitment and initiation at IFN-alpha-stimulated genes (ISGs) promoters and is recruited through interaction with the STAT2 transactivation domain.
23403462 We demonstrate that leukemogenic activity of MLL-AF9 requires RUVBL2 (RuvB-like 2), an AAA+ ATPase family member that functions in a wide range of cellular processes, including chromatin remodeling and transcriptional regulation.
23002137 Two coexisting conformations, compact and stretched, are revealed by analysis of cryo-electron microscopy structures of the RuvBL1-RuvBL2 complex.
22923768 First insight into the mechanism of action of pontin and reptin in the assembly of macromolecular complexes.
22748767 The hexameric crystal structure of TIP49b confirms the validity of molecular models.
22341977 Data suggest that reptin may prove to be a valuable target for prevention and treatment of renal cell carcinoma.
22285491 Ectopic expression of RUVBL2 decreases the levels of ARF, whereas knockdown of RUVBL2 results in a marked increase in ARF levels. In addition, RUVBL2 down-regulates the levels of p53 in an ARF-dependent manner.
21933716 truncation of domain II led to a substantial increase in ATP consumption of RuvBL1, RuvBL2 and their complex. In addition, we present evidence that DNA unwinding of the human RuvBL proteins can be auto-inhibited by domain II
21763315 data firmly implicate RuvBl2 in Ets2 mediated regulation of hTERT in colon cancer which has functional and clinical consequences
20888340 The Reptin docking site was mapped to a divergent octapeptide loop in the AGR2 superfamily between amino acids 104 and 111. Mutations at codon Y104 or F111 in full-length AGR2 destabilized the binding of Reptin.
20603076 Reptin, a chromatin-remodeling factor, is methylated at lysine 67 in hypoxic conditions by the methyltransferase G9a.
20553504 TIP49b hexamers were found to be inactive for ATP hydrolysis and DNA unwinding, suggesting that, in cells, protein factors that remain unknown might be required to recycle these into an active form.
20509972 hTERT transcription requires constitutive expression of Reptin and its cooperation with c-MYC
20412048 Several experimental approaches were used to investigate the molecular architecture of the RuvBL1-RuvBL2 complex and the role of the ATPase-insert domain (domain II) for its assembly and stability.
20371770 RUVBL1 and RUVBL2 control the abundance of Phosphatidylinositol 3-kinase (PI3K)-related protein kinases (PIKKs), and stimulate the formation of PIKK-containing molecular complexes, such as those involved in nonsense-mediated mRNA decay.
20346530 In vivo Reptin depletion leads to tumor growth arrest and may prove a valuable target in hepatocellular carcinoma.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19877184 Reptin and Pontin protein levels are strictly controlled by a posttranslational mechanism involving proteasomal degradation of newly synthesized proteins.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19620283 snoRNP assembly factor NUFIP can regulate the interactions between TIP48 and TIP49 and the core box C/D proteins.
19524533 RVB1 and RVB2 function within multiple protein complexes is reviewed.
19454010 HIV-1 Env antagonizes RUVBL2 by competitive interaction with HIV-1 MA
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
19444951 In human embryonic stem cells the Reptin52 expression increase in cell nuclei during cell differentiation.
19403135 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19369355 RBL2 inhibits influenza virus replication by suppressing influenza A virus polymerases.
19180575 RPAP3 interacts with Reptin to modulate UV-induced DNA damage by regulating H2AX phosphorylation
18765919 Crystal structure has been solved and the solutions obtained show that the RuvBL1-RuvBL2 complex forms a dodecamer.
18358808 Study identifies the ATPases pontin and reptin as telomerase components through affinity purification of TERT from human cells.
17657734 RUVBL2 is overexpressed in a large majority of HCCs. RUVBL2 overexpression enhances tumorigenicity, and RUVBL2 is required for tumor cell viability. These results argue for a major role of RUVBL2 in liver carcinogenesis.
17157868 The results point to biochemical differences between TIP48 and TIP49, which may explain the structural differences between the two hexameric rings and could be significant for specialised functions that the proteins perform individually.
16699503 sumoylation status of reptin modulates the invasive activity of cancer cells with metastatic potential
16230350 similar to the yeast INO80 complex, the hINO80 complex of Tip49a and Tip49b exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding
16157330 The relocation of endogenous TIP48 to the midzone/midbody under physiological conditions suggests a novel and distinct function for TIP48 in mitosis and possible involvement in the exit of mitosis.

AA Sequence

MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAG      1 - 70
RAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEG     71 - 140
EVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFT    141 - 210
RARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKV    211 - 280
AEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDL    281 - 350
LDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE    351 - 420
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS                               421 - 463
//

Text Mined References (99)

PMID Year Title
26863765 2015 [DYNAMICS AND MECHANISMS OF INTERACTION OF HETERO-HEXAMERIC TIP49a/b COMPLEXES WITH DS-DNA].
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26303906 2015 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26211835 2015 HIV-1 Exploits the Host Factor RuvB-like 2 to Balance Viral Protein Expression.
25957047 2015 Reptin physically interacts with p65 and represses NF-?B activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25875766 2015 Reptin regulates DNA double strand breaks repair in human hepatocellular carcinoma.
25652260 2015 Genome-wide screen identifies a novel p97/CDC-48-dependent pathway regulating ER-stress-induced gene transcription.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25437307 2014 LINKIN, a new transmembrane protein necessary for cell adhesion.
25428364 2014 Abundance of the Fanconi anaemia core complex is regulated by the RuvBL1 and RuvBL2 AAA+ ATPases.
25416956 2014 A proteome-scale map of the human interactome network.
25336637 2014 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
24990942 2014 Structure of Yin Yang 1 oligomers that cooperate with RuvBL1-RuvBL2 ATPases.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
24023044 2014 Autoantibodies to RuvBL1 and RuvBL2: a novel systemic sclerosis-related antibody associated with diffuse cutaneous and skeletal muscle involvement.
23891720 2013 Mutually exclusive binding of APPL(PH) to BAR domain and Reptin regulates ?-catenin dependent transcriptional events.
23878400 2013 The human RVB complex is required for efficient transcription of type I interferon-stimulated genes.
23637611 2013 TIP48/Reptin and H2A.Z requirement for initiating chromatin remodeling in estrogen-activated transcription.
23403462 2013 The AAA+ ATPase RUVBL2 is a critical mediator of MLL-AF9 oncogenesis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23002137 2012 Conformational transitions regulate the exposure of a DNA-binding domain in the RuvBL1-RuvBL2 complex.
22923768 2012 Mechanism of the AAA+ ATPases pontin and reptin in the biogenesis of H/ACA RNPs.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22748767 2012 Large-scale conformational flexibility determines the properties of AAA+ TIP49 ATPases.
22341977 2013 Overexpression of reptin in renal cell carcinoma contributes to tumor malignancies and its inhibition triggers senescence of cancer cells.
22285491 2012 RUVBL2 is a novel repressor of ARF transcription.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21933716 2011 Structural and functional insights into a dodecameric molecular machine - the RuvBL1/RuvBL2 complex.
21763315 2011 RuvBl2 cooperates with Ets2 to transcriptionally regulate hTERT in colon cancer.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
21269460 2011 Initial characterization of the human central proteome.
20888340 2010 A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
20801936 2010 Tel2 structure and function in the Hsp90-dependent maturation of mTOR and ATR complexes.
20603076 2010 Negative regulation of hypoxic responses via induced Reptin methylation.
20553504 2010 3'- to 5' DNA unwinding by TIP49b proteins.
20509972 2010 Reptin is required for the transcription of telomerase reverse transcriptase and over-expressed in gastric cancer.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20412048 2010 Oligomeric assembly and interactions within the human RuvB-like RuvBL1 and RuvBL2 complexes.
20371770 2010 AAA+ proteins RUVBL1 and RUVBL2 coordinate PIKK activity and function in nonsense-mediated mRNA decay.
20346530 2010 In vivo silencing of Reptin blocks the progression of human hepatocellular carcinoma in xenografts and is associated with replicative senescence.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19877184 2009 Adenosine triphosphatase pontin is overexpressed in hepatocellular carcinoma and coregulated with reptin through a new posttranslational mechanism.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19620283 2009 Evidence that the AAA+ proteins TIP48 and TIP49 bridge interactions between 15.5K and the related NOP56 and NOP58 proteins during box C/D snoRNP biogenesis.
19524533 2009 RVB1/RVB2: running rings around molecular biology.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
19444951 2009 Reptin52 expression during in vitro neural differentiation of human embryonic stem cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19403135 2009 Identification of CELSR1 as a susceptibility gene for ischemic stroke in Japanese individuals by a genome-wide association study.
19369355 2009 RuvB-like protein 2 is a suppressor of influenza A virus polymerases.
19299493 2009 Biochemical and genetic evidence for a role of IGHMBP2 in the translational machinery.
19180575 2009 RPAP3 interacts with Reptin to regulate UV-induced phosphorylation of H2AX and DNA damage.
18765919 2008 Cloning, expression, purification, crystallization and preliminary X-ray analysis of the human RuvBL1-RuvBL2 complex.
18358808 2008 Identification of ATPases pontin and reptin as telomerase components essential for holoenzyme assembly.
18026119 2007 A YY1-INO80 complex regulates genomic stability through homologous recombination-based repair.
17967892 2008 Transcriptional activation of histone genes requires NPAT-dependent recruitment of TRRAP-Tip60 complex to histone promoters during the G1/S phase transition.
17657734 2007 Overexpression and role of the ATPase and putative DNA helicase RuvB-like 2 in human hepatocellular carcinoma.
17636026 2007 A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17157868 2007 Dodecameric structure and ATPase activity of the human TIP48/TIP49 complex.
16699503 2006 Roles of sumoylation of a reptin chromatin-remodelling complex in cancer metastasis.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16157330 2005 Relocalization of human chromatin remodeling cofactor TIP48 in mitosis.
16014379 2005 The histidine triad protein Hint1 interacts with Pontin and Reptin and inhibits TCF-beta-catenin-mediated transcription.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15829968 2005 Transcriptional regulation of a metastasis suppressor gene by Tip60 and beta-catenin complexes.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15635413 2005 Nucleolar proteome dynamics.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615539 2003 Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11713276 2001 TIP49b, a regulator of activating transcription factor 2 response to stress and DNA damage.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11080158 2000 Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10998447 Human TIP49b/RUVBL2 gene: genomic structure, expression pattern, physical link to the human CGB/LHB gene cluster on chromosome 19q13.3.
10966108 2000 Involvement of the TIP60 histone acetylase complex in DNA repair and apoptosis.
10882073 2000 An ATPase/helicase complex is an essential cofactor for oncogenic transformation by c-Myc.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10524211 1999 Isolation, molecular characterization, and tissue-specific expression of ECP-51 and ECP-54 (TIP49), two homologous, interacting erythroid cytosolic proteins.
10428817 1999 TIP49b, a new RuvB-like DNA helicase, is included in a complex together with another RuvB-like DNA helicase, TIP49a.