Property Summary

NCBI Gene PubMed Count 87
PubMed Score 71.91
PubTator Score 78.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.700 1.5e-07
posterior fossa group B ependymoma 2.500 3.2e-17
glioblastoma 1.400 8.5e-11
group 3 medulloblastoma 1.800 5.2e-07
atypical teratoid / rhabdoid tumor 1.700 1.4e-08
medulloblastoma, large-cell 2.500 2.1e-06
primitive neuroectodermal tumor 1.700 1.7e-05
non-small cell lung cancer 1.389 2.3e-19
lung cancer 2.400 1.8e-05
colon cancer 1.100 5.7e-04
pediatric high grade glioma 1.300 8.0e-09
invasive ductal carcinoma 1.300 1.4e-04
ovarian cancer 1.200 4.8e-03

 IMPC Phenotype (1)

Gene RIF (44)

PMID Text
26863765 by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring
26711270 The interaction of ECD with RUVBL1, and its CK2-mediated phosphorylation, independent of its interaction with PIH1D1, are important for its cell cycle regulatory function.
26303906 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26201077 data thus demonstrate that RUVBL1 is essential for efficient mitosis and proliferation.
25857266 Results highlight an important role and mechanism for Pontin, a new mutp53 partner, in promoting mutp53 GOF in tumorigenesis.
25751257 Study showed that pontin is up-regulated in renal cell carcinoma (RCC) and high cytoplasmic pontin expression was associated with poor survival of RCC patients.
25428364 The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex.
25336637 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
24990942 these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination.
24728183 Results showed RUVBL1 promoting concentration of G-actin subunits and polymerization of actin filaments via its direct binding to F-actin in cell protrusions and results in increased invasive properties of pancreatic ductal adenocarcinoma cells.
24342949 Upregulation of PONTIN by AML1-ETO participate in the oncogenic growth of t(8;21) leukemia cells.
24023044 Anti-RuvBL1/2 antibody is a novel systemic scleroderma-related autoantibody associated with a unique combination of clinical features, including myositis overlap and diffuse cutaneous involvement.
23878400 Data indicate that the RVB1/2 chromatin-remodeling complex is required for efficient Pol II recruitment and initiation at IFN-alpha-stimulated genes (ISGs) promoters and is recruited through interaction with the STAT2 transactivation domain.
23002137 Two coexisting conformations, compact and stretched, are revealed by analysis of cryo-electron microscopy structures of the RuvBL1-RuvBL2 complex.
22923768 First insight into the mechanism of action of pontin and reptin in the assembly of macromolecular complexes.
22895545 Pontin-positivity seems to be a negative predictor for response to adjuvant therapy in colorectal cancer patients and may help to identify patients with adverse outcome in advanced tumor stages.
22190034 HIV-1 Rev interacting protein, RuvB-like 1 (RUVBL1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with RUVBL1 is increased by RRE
22174317 HIV-1 Rev interacting protein, RuvB-like 1 (RUVBL1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with RUVBL1 is increased by RRE
21933716 DNA unwinding of the human RuvBL proteins can be auto-inhibited by domain II, which is not present in the homologous bacterial helicase RuvB.
21825155 Pontin is methylated by G9a/GLP methyltransferases in hypoxic condition and potentiates HIF-1alpha-mediated activation by increasing the recruitment of p300 coactivator to a subset of HIF-1alpha target promoters.
21617703 These results indicate that EHF-mediated RUVBL1 expression allows colon tumour cells to avoid p53-mediated apoptosis.
20635389 Observational study of gene-disease association. (HuGE Navigator)
20412048 Several experimental approaches were used to investigate the molecular architecture of the RuvBL1-RuvBL2 complex and the role of the ATPase-insert domain (domain II) for its assembly and stability.
20371770 RUVBL1 and RUVBL2 control the abundance of Phosphatidylinositol 3-kinase (PI3K)-related protein kinases (PIKKs), and stimulate the formation of PIKK-containing molecular complexes, such as those involved in nonsense-mediated mRNA decay.
20130364 S100A9 and NMP238 expression is associated with concurrent chemoradiotherapy sensitivity in cervical carcinoma.
19877184 Reptin and Pontin protein levels are strictly controlled by a posttranslational mechanism involving proteasomal degradation of newly synthesized proteins.
19620283 snoRNP assembly factor NUFIP can regulate the interactions between TIP48 and TIP49 and the core box C/D proteins.
19524533 RVB1 and RVB2 function within multiple protein complexes is reviewed.
19454010 HIV-1 Rev interacting protein, RuvB-like 1 (RUVBL1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with RUVBL1 is increased by RRE
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
19270026 Observational study of gene-disease association. (HuGE Navigator)
19048121 Phorbol ester enhances KAI1 transcription by recruiting Tip60/Pontin complexes
18834951 The results suggest that as a constituent of chromatin modification complexes TIP49 may facilitate the access of the repair machinery to the sites of DNA damage.
18765919 Crystal structure has been solved and the solutions obtained show that the RuvBL1-RuvBL2 complex forms a dodecamer.
18548265 Pontin was found to associate with RNA polymerase I and to interact in a complex with c-Myc with rDNA sequences indicating that Pontin is involved in the c-Myc-dependent regulation of rRNA synthesis.
18463163 Pontin has a mitosis-specific function in regulating microtubule assembly
18358808 Study identifies the ATPases pontin and reptin as telomerase components through affinity purification of TERT from human cells.
18285460 Rvb1 is critical for the dephosphorylation of phospho-H2AX due to the role of Rvb1 in maintaining the histone acetyltransferase activity of Tip60/NuA4
18087039 pontin is a component of chromatin-remodeling complexes that is SUMO-modified, which has a role in transcriptional regulation of pontin on androgen-receptor target genes in prostate cancer cells
17157868 The results point to biochemical differences between TIP48 and TIP49, which may explain the structural differences between the two hexameric rings and could be significant for specialised functions that the proteins perform individually.
17060327 structure of the RuvBL1.ADP complex, combined with our biochemical results, suggest that although RuvBL1 has all the structural characteristics of a molecular motor, even of an ATP-driven helicase
16230350 similar to the yeast INO80 complex, the hINO80 complex of Tip49a and Tip49b exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding
14695187 TIP49 is an important cofactor in beta-catenin/TCF gene regulation in normal and neoplastic cells, likely functioning in chromatin remodeling.
14675489 Pontin52/TIP49a promotes COX-2 expression in tissue culture and is overexpressed in colon cancer tissue, co-localizing with COX-2 expression in transformed tissue, relative to paired normal tissue

AA Sequence

MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG      1 - 70
PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP     71 - 140
CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA    141 - 210
TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN    211 - 280
KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI    281 - 350
PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN    351 - 420
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK                                      421 - 456
//

Text Mined References (98)

PMID Year Title
26863765 2015 [DYNAMICS AND MECHANISMS OF INTERACTION OF HETERO-HEXAMERIC TIP49a/b COMPLEXES WITH DS-DNA].
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26303906 2015 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26201077 2015 Chromosome Missegregation Associated with RUVBL1 Deficiency.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25857266 2015 Pontin, a new mutant p53-binding protein, promotes gain-of-function of mutant p53.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25751257 2015 Cytoplasmic expression of pontin in renal cell carcinoma correlates with tumor invasion, metastasis and patients' survival.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25437307 2014 LINKIN, a new transmembrane protein necessary for cell adhesion.
25428364 2014 Abundance of the Fanconi anaemia core complex is regulated by the RuvBL1 and RuvBL2 AAA+ ATPases.
25416956 2014 A proteome-scale map of the human interactome network.
25336637 2014 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24990942 2014 Structure of Yin Yang 1 oligomers that cooperate with RuvBL1-RuvBL2 ATPases.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24728183 2014 RUVBL1 directly binds actin filaments and induces formation of cell protrusions to promote pancreatic cancer cell invasion.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
24342949 2014 Pontin is a critical regulator for AML1-ETO-induced leukemia.
24023044 2014 Autoantibodies to RuvBL1 and RuvBL2: a novel systemic sclerosis-related antibody associated with diffuse cutaneous and skeletal muscle involvement.
23878400 2013 The human RVB complex is required for efficient transcription of type I interferon-stimulated genes.
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23002137 2012 Conformational transitions regulate the exposure of a DNA-binding domain in the RuvBL1-RuvBL2 complex.
22923768 2012 Mechanism of the AAA+ ATPases pontin and reptin in the biogenesis of H/ACA RNPs.
22895545 2012 Increased Pontin expression is a potential predictor for outcome in sporadic colorectal carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21933716 2011 Structural and functional insights into a dodecameric molecular machine - the RuvBL1/RuvBL2 complex.
21825155 2011 Hypoxia-induced methylation of a pontin chromatin remodeling factor.
21617703 2011 A member of the ETS family, EHF, and the ATPase RUVBL1 inhibit p53-mediated apoptosis.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
21269460 2011 Initial characterization of the human central proteome.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
20635389 2011 Common alleles in candidate susceptibility genes associated with risk and development of epithelial ovarian cancer.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20412048 2010 Oligomeric assembly and interactions within the human RuvB-like RuvBL1 and RuvBL2 complexes.
20371770 2010 AAA+ proteins RUVBL1 and RUVBL2 coordinate PIKK activity and function in nonsense-mediated mRNA decay.
20130364 2010 [Significance and expression of S100A9 and NMP238 in cervical carcinoma tissues with different concurrent chemoradiotherapy sensitivities].
19877184 2009 Adenosine triphosphatase pontin is overexpressed in hepatocellular carcinoma and coregulated with reptin through a new posttranslational mechanism.
19620283 2009 Evidence that the AAA+ proteins TIP48 and TIP49 bridge interactions between 15.5K and the related NOP56 and NOP58 proteins during box C/D snoRNP biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19524533 2009 RVB1/RVB2: running rings around molecular biology.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
19299493 2009 Biochemical and genetic evidence for a role of IGHMBP2 in the translational machinery.
19270026 2009 Functional complementation studies identify candidate genes and common genetic variants associated with ovarian cancer survival.
19179534 2009 A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19048121 2008 Phorbol ester enhances KAI1 transcription by recruiting Tip60/Pontin complexes.
18834951 2009 RAD51 foci formation in response to DNA damage is modulated by TIP49.
18765919 2008 Cloning, expression, purification, crystallization and preliminary X-ray analysis of the human RuvBL1-RuvBL2 complex.
18548265 2008 Pontin is localized in nucleolar fibrillar centers.
18463163 2008 Regulation of microtubule assembly and organization in mitosis by the AAA+ ATPase Pontin.
18358808 2008 Identification of ATPases pontin and reptin as telomerase components essential for holoenzyme assembly.
18285460 2008 Human Rvb1/Tip49 is required for the histone acetyltransferase activity of Tip60/NuA4 and for the downregulation of phosphorylation on H2AX after DNA damage.
18087039 2007 SUMOylation of pontin chromatin-remodeling complex reveals a signal integration code in prostate cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18026119 2007 A YY1-INO80 complex regulates genomic stability through homologous recombination-based repair.
17967892 2008 Transcriptional activation of histone genes requires NPAT-dependent recruitment of TRRAP-Tip60 complex to histone promoters during the G1/S phase transition.
17761535 2007 Functional characterization of the OFD1 protein reveals a nuclear localization and physical interaction with subunits of a chromatin remodeling complex.
17636026 2007 A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17157868 2007 Dodecameric structure and ATPase activity of the human TIP48/TIP49 complex.
17060327 2006 Crystal structure of the human AAA+ protein RuvBL1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16014379 2005 The histidine triad protein Hint1 interacts with Pontin and Reptin and inhibits TCF-beta-catenin-mediated transcription.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695187 2003 TIP49 regulates beta-catenin-mediated neoplastic transformation and T-cell factor target gene induction via effects on chromatin remodeling.
14675489 2003 Regulation of COX-2 transcription in a colon cancer cell line by Pontin52/TIP49a.
14615539 2003 Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI.
14506706 2003 The ATP-dependent helicase RUVBL1/TIP49a associates with tubulin during mitosis.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11839798 2002 BAF53 forms distinct nuclear complexes and functions as a critical c-Myc-interacting nuclear cofactor for oncogenic transformation.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11080158 2000 Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity.
11027681 2001 Purification, cloning, and characterization of a profibrinolytic plasminogen-binding protein, TIP49a.
10966108 2000 Involvement of the TIP60 histone acetylase complex in DNA repair and apoptosis.
10902922 2000 Chromosome mapping and expression of human tip49 family genes.
10882073 2000 An ATPase/helicase complex is an essential cofactor for oncogenic transformation by c-Myc.
10524211 1999 Isolation, molecular characterization, and tissue-specific expression of ECP-51 and ECP-54 (TIP49), two homologous, interacting erythroid cytosolic proteins.
10428817 1999 TIP49b, a new RuvB-like DNA helicase, is included in a complex together with another RuvB-like DNA helicase, TIP49a.
9843967 1998 Pontin52, an interaction partner of beta-catenin, binds to the TATA box binding protein.
9813143 1998 Identification and characterization of the ubiquitously occurring nuclear matrix protein NMP 238.
9774387 1998 An eukaryotic RuvB-like protein (RUVBL1) essential for growth.
9588198 1998 TIP49, homologous to the bacterial DNA helicase RuvB, acts as an autoantigen in human.
9196036 1997 Molecular cloning of a rat 49-kDa TBP-interacting protein (TIP49) that is highly homologous to the bacterial RuvB.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.