Property Summary

NCBI Gene PubMed Count 92
PubMed Score 79.02
PubTator Score 78.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.100 3.9e-05
atypical teratoid / rhabdoid tumor 1.700 1.4e-08
colon cancer 1.100 5.7e-04
ependymoma 1.800 3.6e-02
glioblastoma 1.400 8.5e-11
group 3 medulloblastoma 1.800 5.2e-07
invasive ductal carcinoma 1.300 1.4e-04
lung cancer 1.400 4.5e-03
malignant mesothelioma 1.700 1.5e-07
medulloblastoma, large-cell 2.500 2.1e-06
non-small cell lung cancer 1.389 2.3e-19
ovarian cancer 1.200 4.8e-03
primitive neuroectodermal tumor 1.700 1.7e-05

Synonym

Accession Q9Y265 B2R5S0 P82276 Q1KMR0 Q53HK5 Q53HL7 Q53Y27 Q9BSX9
Symbols RVB1
TIH1
ECP54
TIP49
ECP-54
INO80H
NMP238
PONTIN
TIP49A
NMP 238
Pontin52

Gene

 IMPC Phenotype (1)

Gene RIF (49)

AA Sequence

MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG      1 - 70
PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP     71 - 140
CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA    141 - 210
TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN    211 - 280
KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI    281 - 350
PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN    351 - 420
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK                                      421 - 456
//

Text Mined References (105)

PMID Year Title