Property Summary

NCBI Gene PubMed Count 515
PubMed Score 1788.99
PubTator Score 1284.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Hematologic cancer 9 0.0 1.0
Immune system cancer 38 0.0 1.0
Disease Target Count Z-score Confidence
Esophageal cancer 30 0.0 2.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 6.226 3.1
Disease Target Count Z-score Confidence
Cleidocranial dysplasia 10 4.126 2.1
Thrombocytopenia 105 3.778 1.9

Expression

  Differential Expression (24)

Gene RIF (455)

PMID Text
27100087 A statistically significant gain of methylation at CpG dinucleotide sites within the RUNX1 gene is observed in individuals with free trisomy 21 (Down syndrome) compared with control disomic samples. The gain is independent of the maternal or the paternal origin of the chromosome 21 nondisjunction event.
26990877 we observed that inhibition of RUNX1/ETO in Kasumi1 cells and in RUNX1/ETO positive primary acute myeloid leukemia patient samples leads to up-regulation of miR144/451
26916619 RUNX1 and ER occupy adjacent elements in AXIN1's second intron, and RUNX1 antagonizes oestrogen-mediated AXIN1 suppression.
26907657 RUNX1 amplification may predispose to early thrombotic events in children with B-cell acute lymphoblastic leukemia
26901859 in hematopoietic cells RUNX1 protein is recruited to its own promoter to regulate RUNX1 gene transcription in a positive feedback loop.
26852652 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26849013 RUNX1 haploinsufficiency collaborates with genetic alterations conferring clonal advantage such as TET2 mutation or trisomy 21 to establish pre-leukemic state.
26745853 Runx1 haploinsufficiency appears to predispose FPD patients to MM by expanding the pool of stem/progenitor cells and blocking myeloid differentiation in response to G-CSF.
26716895 Low expression of RUNX1 is associated with malignant progression of gastric cancer.
26706127 Data suggest that biosynthesis and folding of leukemogenic fusion oncoprotein AML1-ETO/RUNX1-RUNX1T1 is facilitated by interaction with the chaperonin TRiC/CCT1/TCP1 and HSP70 (heat shock protein 70).
26674644 RUNX1-Evi-1 may promote proliferation and apoptosis resistance of primitive hematopoietic cell, and inhibit the differentiation of myeloid cells with the synergy of different pathways and factors.
26671595 Two novel translocations leading to the inactivation of RUNX1 and its partners SIN3A and TCF12 in myeloid leukemia.
26625756 The study shows a low representation of ETV6-RUNX1 fusion oncogenes among pediatric acute lymphoblastic leukemia patients from King Abdulaziz Medical City, National Guard Health Affairs, Riyadh, Saudi Arabia.
26580584 We conclude that the distal P1-Runx1 promoter is a direct transcriptional target of Wnt/beta-catenin signaling that may be important in normal hematopoiesis or its transition into malignant stem cells during the onset or progression of leukemia.
26580398 our results demonstrate that MIR181A1 and ETV6/RUNX1 regulate each other, and we propose that a double negative loop involving MIR181A1 and ETV6/RUNX1 may contribute to ETV6/RUNX1-driven arrest of differentiation in pre-B ALL.
26546158 AML1/ETO transactivates gene expression through recruiting AP-1 to the AML1/ETO-AML1 complex.
26449661 The study reveals a role of CBL in restricting myeloid proliferation of human AML1-ETOinduced leukemia, and identifies UBASH3B as a potential target for pharmaceutical intervention.
26418744 Thus, an NGF/TrkA-MAPK-CBFbeta pathway converges with Islet1-Runx1 signaling to promote Runx1/CBFbeta holocomplex formation and nonpeptidergic nociceptor maturation.
26320575 Exon splicing patterns in the human RUNX1-RUNX1T1 fusion gene present in acute myeloid leukemia patients have been decoded.
26316320 Germline RUNX1 mutations are associated with leukemic progression of familial platelet disorder with predisposition to acute myeloid leukemia.
26237075 We observed significant enrichment of the neuroactive ligand-receptor interaction pathway in TCF3-PBX1 as well as an enrichment of genes involved in immunity and infection pathways in ETV6-RUNX1 subtype
26214902 The amplification of c-MYC, MLL and RUNX1 genes is related to the progressive changes of the karyotype in patients with AML and MDS with trisomy 8, 11 and 21 in bone marrow, and is a part of the clonal evolution.
26185316 RUNX1 copy numbers seem to be proportional to the age of childhood B-acute lymphoblastic leukemia onset and the frequency of CSF involvement, while RUNX1 amplification vs translocation causes aberrant expression of CD7 and CD13, respectively
26175287 WASP, RUNX1, and ANKRD26 genes are important for normal TPO signaling and the network underlying thrombopoiesis.
26165925 Runx1-deficient hematopoietic stem and progenitor cells (HSPCs) have a slow growth, low biosynthetic, small cell phenotype and markedly reduced ribosome biogenesis.
26161748 Data show that the Lim domain only 2 (LMO2) regulatory element (element-25) region consists of transcription factor GATA2-binding myeloid ennhancer and RUNX protein-binding T-cell repressor.
26021490 These findings clearly indicate that the RUNX1 mutation is robustly associated with thrombocytopenia in patients with FPD/AML
26010396 Loss of RUNX1/AML1 arginine-methylation impairs peripheral T cell homeostasis.
25911237 data indicate that the repressive function of RUNX1 influences the balance between erythroid and megakaryocytic differentiation by shifting the balance between KLF1 and FLI1 in the direction of FLI1.
25893288 TEL-AML1 fusion protein blocks B-cell differentiation and downregulates the IRF3-IFNalpha/beta pathway by modulating expression and phosphorylation of IRF3 in human primary hematopoietic precursor cells.
25879624 We have identified CHD1 as the RUNX1 fusion partner in acute myeloid leukemia with t(5;21)(q21;q22).
25840971 The biologic activity rather than the mutational status of RUNX1 might be an indicator in predicting outcome of patients with chronic myelomonocytic leukemia (CMML) and myelodysplastic syndromes (MDS)
25801305 The transcriptional regulation of CD69 gene through a potent enhancer located in the conserved non-coding sequence 2 is mediated by transcription factors such as RUNX1.
25656571 In addition, RUNX-1 is a novel direct target of miR-27a, which is involved in its regulation of chemo-sensitivity in bladder cancer.
25612891 miR-17 deregulates a core RUNX1-miRNA mechanism of CBF acute myeloid leukemia.
25596267 ASXL1 mutation, particularly in the context of a coexisting RUNX1 mutation, constitutes a strong adverse prognostic factor in acute myeloid leukemia.
25575569 Expression of RUNX1, a target of RAD21, was reduced in cells from patients with chronic intestinal pseudo-obstruction compared with controls.
25562167 MiR-302b functions as a tumor suppressor in EOC by targeting RUNX1 and modulating the activity of the STAT3 signaling pathway.
25546363 RUNX1 regulates the development of hematopoietic stem cells from embryonic stem cells and induced pluripotent cells.
25537508 Data show that sepression of runt-related transcription factor (RUNX1) is important for the growth promotion ability of enhancer of zeste homolog 2 (EZH2) in androgen receptor (AR)-independent cells.
25490895 RUNX1 dosage could explain the differential phenotype according to RUNX1 mutations, with a haploinsufficiency leading to thrombocytopenia alone in a majority of cases whereas a more complete gene deletion predisposes to leukemia.
25486427 These results indicated that lincRNA-uc002yug.2 might involve in AS of RUNX1/AML1 and serve as a predictor for esophageal cancer and prognosis.
25452107 miR-18a and RUNX1 could reversely regulate the permeability of blood-tumor barrier as well as the expressions and distributions of ZO-1, occludin and claudin-5.
25388957 The pre-leukemic initiating function of ETV6-RUNX1 fusion is associated with clonal expansion early in the fetal B-cell lineage.
25313057 RUNX1 was required for prostatic mesenchymal stem cell cell-cycle progression and proliferation. It inhibited, yet did not block, differentiation. It is a key transcription factor for MSC cell fate commitment in myofibroblast differentiation.
25263451 A comprehensive overview of RUNX1 post-translational modifications(PTMs) from biochemical and biologic perspectives; how aberrant PTMs of RUNX1 might contribute to tumorigenesis and strategies to develop anticancer therapies targeting RUNX1 PTMs.[review]
25185713 Runx-dependent PU.1 chromatin interaction and transcription of PU.1 are essential for both normal and leukemia stem cells.
25135298 direct Ddelta2-Jdelta1 rearrangements are prohibited by a B12/23 restriction and ordered TCR-delta gene assembly requires RUNX1 protein, which binds to the Ddelta2-23RSS, interacts with RAG1, and enhances RAG1 deposition at this site
25114263 confirm that RUNX1 mutations are responsible for megakaryopoietic defects in familial platelet disorder with predisposition to acute myeloid leukemia
25101977 In t(8;21) acute myelogenous leukemia (AML), the acquisition of AML1/ETO is not sufficient, and the subsequent upregulation of AML1/ETO and the additional c-KIT mutant signaling are critical steps for transformation into leukemic stem cells.
25082877 minimal residual disease determined by RUNX1/RUNX1T1 transcript levels could identify allogeneic hematopoietic stem cell transplantation t(8;21) (q22;q22) acute myeloid leukemia patients who are at high risk for relapse, together with c-KIT mutations
25066867 incidence of RUNX1 mutations in Arab Asian children and adolescents with acute myeloid leukemia was 5.6%
25025858 The 2 genes RUNX1 and SP7 resulted differently expressed in cells cultured on metallic supports if compared with the expression recorded for OIC
24973361 identify a high-frequency mutation in t(8;21)/RUNX1-RUNX1T1 acute myekoid leukemia (AML) and identify the need for future studies to investigate the clinical and biological relevance of ASXL2 mutations in this unique subset of AML
24972750 This meta-analysis demonstrates that the SLC22A4 F1 polymorphism is associated with susceptibility to RA in East Asians, but not in Europeans.
24967588 RUNX1 as a new prognostic indicator correlating with poor prognosis specifically in the triple negative subtype of human breast cancer
24897507 RUNX1/ETO-induced DNA damage and apoptosis in human primary CD34+ hematopoietic progenitors are rescued by activating c-Kit mutations
24792891 RUNX1 point mutations potentially identify a subset of early immature T-cell acute lymphoblastic leukaemia that may originate from differentiated T-cells.
24783204 Our data shows that upregulated of the RUNX1-RUNX1T1 gene set maybe an important factor contributing to the etiology of ccRCC.
24756106 there seems to be a RUNX1/AML1 translocation from cytoplasm to nucleus in endometrioid endometrial carcinoma neoplastic transformation.
24752773 an RUNX1-intragenic long noncoding RNA, RUNXOR, may function as a previously unidentified candidate component that is involved in chromosomal translocation in hematopoietic malignancies
24732596 this study demonstrated that haploinsufficient RUNX1 allele imposed cell-intrinsic defects on hematopoietic differentiation in human experimental settings and revealed differential impacts of RUNX1 dosage on human and murine megakaryopoiesis.
24727677 A reduction in KIT mRNA levels was observed in AE-silenced cells, but silencing KIT expression reduced cell growth but did not induce apoptosis.
24716598 Low expression of Runx1 along with reduced proportion of Treg in CD4(+) T cells may be associated with development of systemic sclerosis even in early disease.
24695740 Data indicate that transcription factors RUNX1 and PU.1 cooperated to exchange corepressors for coactivators, and deficiency of RUNX1, frequent in leukemia, caused aberrant recruitment of specific corepressors instead of coactivators to PU.1.
24673627 we report, for the first time, the identification of a RUNX1-USP42 fusion transcript detected at diagnosis in a child with AML and del(5).
24651404 Our findings indicate that RUNX1 and CBF-beta cooperate in cells to modulate HIV-1 replication
24646888 Ets1 is activated by Runx1 in human cells
24616160 Discordant MRD results were observed in 10/71 (14%) of the samples: in three samples from two patients who relapsed, RUNX1-RUNX1T1 was detectable only on DNA, while RUNX1-RUNX1T1 was detectable only on RNA in seven samples.
24606315 the RUNX1 target NF-E2 is part of the molecular network by which RUNX1 regulates platelet biogenesis and function in a pedigree with familial platelet disorder with a predisposition to acute myelogenous leukemia
24523240 The detection of both RUNX1 and CSF3R mutations could be used as a marker for identifying Congenital neutropenia patients with a high risk of progressing to leukemia or myelodysplastic syndromes.
24456692 The AML1/ETO target gene LAT2 interferes with differentiation of normal hematopoietic precursor cells.
24449215 Downregulation of RUNX1/CBFbeta by MLL fusion proteins enhances hematopoietic stem cell self-renewal.
24402164 t(8;21)/RUNX1-RUNX1T1-positive AML shows a high frequency of additional genetic alterations.
24388988 miR-675 was positively expressed with H19 and was a pivotal mediator in H19-induced gastric cancer cell growth promotion. Subsequently, the tumor suppressor Runt Domain Transcription Factor1 (RUNX1) was confirmed to be a direct target of miR-675.
24339741 ETV6/RUNX1 expression enhances ROS.
24327541 TOP2B influences the separation between RUNX1 and two translocation partners (RUNX1T1 and EVI) in the nucleus of lymphoid cells.
24321385 Cohesin (but not CTCF) depletion enhanced RUNX1 expression in a human leukemia cell line, suggesting conservation of RUNX1 regulation through evolution
24297870 RUNX1 and NF-E2 are overexpressed in polycythemic patients of diverse phenotypes and molecular causes
24240203 Our findings clarify the role of p53 signaling in ETV6/RUNX1-positive leukemias and outline the potential basis for its therapeutic exploitation in this setting
24130502 This identifies KLF6 as a novel mediator of t(8;21) target gene regulation, providing a new mechanism for RUNX1-ETO transcriptional control.
24100448 alterations in FLI1 and RUNX1 may be common in patients with platelet dense granule secretion defects and mild thrombocytopenia.
24055056 An active RUNX1 allele is usually preserved in both t(8;21) or inv(16) AML patients, whereas RUNX1 is frequently inactivated in other forms of leukemia.
24035334 RUNX1-RUNX1T1 fusion is associated with acute myeloid leukemia with t(8;21) (q22;q22)
24007691 LGALS3 expression appeared to be a predictive factor of the aggressive behavior of prolactin and adrenocorticotropic hormone-functioning pituitary adenomas, and its expression was correlated with RUNX1 expression levels.
24002588 found that CBFbeta-MYH11 localizes to RUNX1 occupied promoters, where it interacts with TAL1, FLI1 and TBP-associated factors (TAFs) in the context of the hematopoietic transcription factors
23979164 RUNX1 plays an unexpected prosurvival role in myeloid leukemogenesis.
23958918 deep-sequencing revealed that RUNX1 mutations qualify as patient-specific markers for individualized disease monitoring
23874874 Runx1 directly regulates c-Myc transcription in a C-terminal- and DNA-binding-dependent manner.
23848403 RUNX1, but not its mutants, strongly and synergistically activates PF4 expression along with ETS family proteins
23753029 It is unusual for RUNX1 to be found with NPM1 germline mutations in patients with acute myeloid leukemia, as in this study.
23741012 these data indicate a direct role for TEL-AML1, via increasing the activity of RAC1, in regulating the phosphorylation of signal transducer and activator of transcription 3 (STAT3), which results in transcriptional induction of MYC.
23528260 Patients with c-KIT mutations tended to achieve a greater than 3-log reduction in RUNX1/RUNX1T1 fusion transcript expression less frequently than patients without mutation.
23527860 using the reverse transcription-polymerase chain reaction with outward-facing primers, we identified a novel non-polyadenylated transcript from the AML1 gene, with exons 5 and 6 scr
23488608 The ETV6/RUNX1 fusion transcript is not detected in RNA isolated from neonatal dried blood spots from children later diagnosed with the corresponding leukemia.
23471304 RUNX1 mutation collaborates with BMI1 overexpression in the development of human and murine myelodysplastic syndromes.
23443342 Our mouse model provides support for TEL-AML1 leukemogenesis where low dose radiation caused mutations.
23442798 data are indicative for a strong oncogenic potential of the RUNX1 gene in epithelial ovarian cancer progression
23426948 Importance of the degree of dysregulation by AML1-ETO in cellular transformation.
23372166 Results suggest that RUNX1a facilitates the process of producing therapeutic hematopoietic progenitor cells (HPCs) from human pluripotent stem cell (hPSC).
23352661 The RUNX1 gene is directly activated by MLL-AF4 and the RUNX1 protein interacts with the product of the reciprocal AF4-MLL translocation.
23352661 RUNX1 gene is directly activated by MLL-AF4 and the RUNX1 protein interacts with the product of the reciprocal AF4-MLL translocation.
23350231 structure, isoforms, covalent modifications of the RUNX1 transcription factor and its participation in different regulatory cascades. Expression regulation, mutations and chromosomal translocations of the RUNX1 gene.
23344057 Studies indicate that a number of miRNAs can inhibit runt-related transcription factor 1 (RUNX1) protein expression by targeting the 3' untranslated region (3'UTR) of RUNX1 mRNA.
23341344 Data indicate that NOTCH1 was the most frequently mutated gene in T-cell acute lymphoblastic leukemia (T-ALL), and ANDRUNX1 and DNMT3A were frequently mutated in T-ALL and associated with poor prognosis in early T-ALL.
23333304 HIV-1 Vif modulates cellular gene expression with RUNX1-associated regulatory domains
23327922 Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells.
23321257 Minimal residual disease, rather than gene mutations, should be used for future treatment stratifications in CBF-acute myeloid leukemia patients.
23254331 The ability of RUNX1c to prevent B cell growth specifically requires the N-terminus of RUNX1c, as RUNX1b does not cause the growth inhibition.
23223432 Our results indicated a feedback circuitry involving miR-193a and AML1/ETO/DNMTs/HDACs, cooperating with the PTEN/PI3K signaling pathway and contributing to leukemogenesis.
23175372 Authors revealed that different lengths and regions are required for CBFbeta to assist HIV-1 Vif or RUNX1.
23175372 HIV-1 Vif modulates cellular gene expression with RUNX1-associated regulatory domains
23148227 results strongly suggest that RUNX1 is required for the stimulation of p53 in response to DNA damage and also provide novel insight into understanding the molecular mechanisms behind p53-dependent DNA damage response
23086478 PKC-theta is regulated by a new pathway in which NOTCH1 induces runt-related transcription factor 3 (RUNX3), RUNX3 represses RUNX1 and RUNX1 induces PKC-theta.
23065512 Data show that myelodysplastic chronic myelomonocytic leukemias are characterized by mutations in transcription/epigenetic regulators ASXL1, RUNX1, TET2 and SRSF2.
23034403 High Runx1 expression is associated with epithelial cancer.
23028138 DNA methylation of genes in retinol metabolism and calcium signaling pathways (P < 3 x 10-6) and with known functions in muscle and T2D including MEF2A, RUNX1, NDUFC2, and THADA decreased after exercise
22995345 Study showed that in a widely used AML cell line, Kasumi-1, the chimeric AML1/ETO gene, is transcribed from the promoter P2 of AML1 gene, and this process does not depend on the formation of distant interactions between this promoter and the fused segment of ETO gene.
22919028 disruption of the expression of genes related to normal aging by RUNX1 mutations contributes to development of myelodysplastic syndrome (MDS).
22898599 Dysmegakaryopoiesis of familial platelet disorder and acute myelogenous leukemia pedigrees with constitutional RUNX1 mutations is linked to myosin II deregulated expression.
22865593 RUNX1 gene variants are associated with esophageal squamous cell carcinoma.
22828445 high EVI-1 levels are associated with acute lymphoblastic leukemia.
22777353 RUNX1 activity in hematopoietic progenitor cells maintains differentiation genes in a suppressed state but poised for rapid transcriptional activation.
22753902 RUNX1 mutations are twice as common in older than younger patients with cytogenetically normal acute myeloid leukemia and negatively impact outcome in both age groups.
22748822 Expression of RUNX1 isoforms and its target gene BLK in childhood acute lymphoblastic leukemia.
22725134 These separation-of-function mutants demonstrate that HIV-1 Vif and the RUNX transcription factors interact with cellular CBFbeta on genetically distinct surfaces.
22689681 RUNX1 mutations are associated with acute myeloid leukemia.
22689058 Authors define the minimal promoter region of EVI1 and demonstrate that RUNX1 and ELK1, two proteins with essential functions in hematopoiesis, regulate EVI1 in AML.
22673192 the importance of tight control of the functional interplay between DeltaNp63 and p53 in regulating RUNX1 transcription factor expression for proper regulation of interfollicular epidermal homeostasis.
22551552 Runx1 plays an essential role in repressing the transcription of cytokine genes in naive CD4+ T cells and, thereby, maintains cell quiescence.
22498736 PRMT1 interacts with AML1-ETO to promote its transcriptional activation and progenitor cell proliferative potential.
22430633 Three RUNX1 mutations are associated with acyte myeloid leukemia.
22419089 fragment of RUNX1 intron is neither enhancer nor a silencer
22404039 The present study sheds further light on the genetic diversity of ETV6/RUNX1-positive childhood ALL, which may be important for understanding poor responses among this otherwise highly curable subset of ALL and lead to novel targeted treatment strategies.
22366949 these results place TLX1 and TLX3 at the top of an oncogenic transcriptional network controlling leukemia development, and identify RUNX1 as a tumor-suppressor gene in T-ALL
22343733 selective removal of RUNX1/ETO leads to a widespread reversal of epigenetic reprogramming and a genome-wide redistribution of RUNX1 binding, resulting in the inhibition of leukemic proliferation and self-renewal, and the induction of differentiation.
22318203 RUNX1 abnormalities may promote acute myeloid leukemic transformation in a subset of chronic myeloid leukemia patients
22253733 These results unveil a novel interaction of SARS-CoV 3b with the host factor, RUNX1b.
22221250 Amplified segment in the 'Down syndrome critical region' on HSA21 shared between Down syndrome and euploid AML-M0 excludes RUNX1, ERG and ETS2.
22201794 In this review, we detail the structural features, functions, and models used to study both RUNX1 and RUNX1-ETO in hematopoiesis over the past two decades
22163048 analysis of upregulation of the cell-cycle regulator RGC-32 in Epstein-Barr virus-immortalized cells, due to transcriptional activation by high levels of the differentially expressed RUNX1c transcription factor
22145956 Data suggest that the presence of the KIT D816V mutation in the core-binding factor acute myeloid leukemia (CBF AML) subgroup can not be considered indicative of associated systemic mastocytosis (SM).
22094587 results provide a first rationale and justification for targeting the ETV6/RUNX1 fusion gene and the PI3K/AKT/mTOR pathway therapeutically
22081516 Chromosomal regions of homozygous loss, encompassing the ITGAV and RUNX1 gene, were detected in multiple samples indicating a potential role in the carcinogenesis of esophageal adenocarcinoma.
22076464 findings demonstrate that germline genetic variation can specifically contribute to the risk of ETV6-RUNX1-positive childhood ALL
22032690 Runx2 and CBFbeta are required for the expression of genes that mediate the ability of metastatic breast cancer cells to directly modulate both osteoclast and osteoblast function.
22028862 the continuous expression of the ETV6/RUNX1 fusion gene interferes with key regulatory functions that shape the biology of acute lymphoblastic leukemia
22025082 Submicroscopic deletion of RUNX1T1 gene confirmed by high-resolution microarray in acute myeloid leukemia with RUNX1/RUNX1T1 rearrangement
22024923 RUNX1 could act as a tumor suppressor gene in breast cancer.
22021368 Findings show a novel role for AML1 as a cytoplasmic attenuator of NF-kappaB signaling and indicate that NF-kappaB signaling is one of the promising therapeutic targets of hematologic malignancies with AML1 abnormality.
22012064 Studies identified a physical and functional interaction between RUNX1 (AML1) and MLL and show that both are required to maintain the histone lysine 4 trimethyl mark (H3K4me3) at 2 critical regulatory regions of the AML1 target gene PU.1.
21900195 ETV6-RUNX1 directly activates ectopic expression of a functional EPOR and provides cell survival signals that may contribute critically to persistence of covert premalignant clones in children.
21873977 RUNX1 regulates the CD34 gene in haematopoietic stem cells by mediating interactions with a distal regulatory element
21869842 ETV6-RUNX1 was associated with age 1-9 years, pre-treatment classification as low risk and lower levels of minimal residual disease in acute lymphoblastic leukemia on day 19 of therapy
21836608 found that RUNX1 directly regulates the transcription of GADD45A and that RUNX1 and p53 synergistically activate the GADD45A transcription
21836606 PIG7 could be transactivated by AML1, which subsequently induces differentiation and apoptosis of leukemia cells, especially those with AML1-ETO fusion gene
21828118 RUNX1 mutations are an important novel biomarker for a comprehensive characterization of T-cell acute lymphoblastic leukemia with poor prognostic impact and have implications for use also in monitoring disease.
21822204 Report prognosis in pediatric B-lymphoblastic leukemia with RUNX1 amplification.
21803869 SNPs in RUNX1 are associated with airway responsiveness in asthmatic children and these associations are modified by intrauterine smoke exposure exposure.
21799513 results suggest MYCT1 transcription can be activated downstream of RUNX1-ETO as well as MYC, contributing to key aspects of the leukaemic phenotypes these oncoproteins promote
21764752 study found AML1-ETO is acetylated by the transcriptional coactivator p300 in leukemia cells isolated from t(8;21) AML patients, and this acetylation is essential for its self-renewal-promoting effects in cord blood CD34(+) cells and its leukemogenicity
21725049 Data on familial platelet disorder/acute myelogenous leukemia (FPD/AML) indicate NR4A3 is direct target of RUNX1. Data on hematopoiesis in FPD/AML w/ RUNX1 mutations indicate that R139X results in pedigree w/o AML; R174Q results in pedigree w/ AML.
21723253 These data demonstrate that RUNX1 is an important regulator of SERPINB13 and cathepsin K activity.
21640801 Over-expression of RUNX1 also induces cell death, as well as cell cycle arrest or differentiation in neuroblastoma cells.
21576367 Data show that Runx1, in conjunction with Fli1, Gata2, and Scl, directly regulates the expression of Smad6 in the aorta-gonad-mesonephros region in the developing embryo, where hematopoietic stem cells originate.
21571218 The genome-wide binding sites for the RUNX1 in primary human megakaryocytes to identify the essential regulator of complex mammalian differentiation processes.
21518930 RUNX1 deficiency is associated with persistent corepressor interaction with PU.1.
21493867 transcription factor Evi-1 is overexpressed in infratentorial ependymomas, promotes proliferation of ependymal tumor cells, and is prognostically unfavorable.
21447743 In normal cells AML1/RUNX1 acts as a repressor for VEGFA, in AML cells VEGFA expression is upregulated due to AML1/RUNX1 aberrations, for example, AML1/ETO. These observations give insight in the regulation of VEGFA at the mRNA level in AML.
21445863 Transcriptional regulation and spatial organisation of the human AML1/RUNX1 gene
21380778 t(10;21)translocation that disrupts the RUNX1 gene is associated with acute myeloid leukemia.
21343560 Acute myeloid leukemias with RUNX1 mutations are characterized by distinct genetic properties and are associated with resistance to therapy and inferior outcome.
21332713 no RUNX1 coding changes were detected in mononuclear cells or erythropoietin-independent erythroid blast-forming units of the chronic phase polycythaemia vera patients indicating that mutations are infrequent in this phase of the disease
21325596 RUNX1 and other chromosomal/genomic lesions were found at the myolodysplasia and leukemia stages of Fanconi anemia, except for 1q+, which was found at all stages
21322790 transient overexpression of Runx1 has a potent influence on phenotypic differentiation of peripherally transplanted human neural stem/progenitor cells
21294243 During the course of this investigation, valuable data were obtained concerning RUNX1 gene mutation frequencies in different clinical, morphological, and cytogenetic groups of patients with myeloid malignancies
21292764 Runx1 involves negative auto-regulation of the distal Runx1 promoter and contributes to IL-2 production.
21283084 Alterations of the RUNX1 gene is associated with myelodysplastic syndromes and acute myeloid leukemia.
21268063 propose a new disease category of myelodysplastic neoplasms (MDN); RUNX1 mutations detected in about 20% of cases of "MDN"; it is suspected the "MDN" phenotypes are defined by the RUNX1 mutations in addition to some other abnormalities
21252065 PRKCQ is regulated by RUNX1 in megakaryocytes and platelets, and provide an explanation for the decreased PKC-theta expression in RUNX1 haplodeficiency.
21233836 RUNX1 mutation is associated with myelodysplastic syndromes.
21224468 These findings implicate glucocorticoid-associated drug resistance in ETV6/RUNX1-positive relapse pathogenesis.
21204219 The 21q22.11q22.12 microdeletion involving RUNX1 represents a new distinctive microdeletion syndrome, in which thrombocytopenia, corpus callosum abnormalities, and cardiac malformation are frequent phenotypic manifestations.
21200020 N-Ras(G12D) induces features of stepwise transformation in preleukemic umbilical cord blood cultures expressing the AML1-ETO fusion gene.
21166663 Expression of the critical transcription factor RUNX1, was abnormal, and augmentation of these levels might induce dysfunction of marrow haematopoietic stem cells and the haematopoietic microenvironment and be involved in the progression of psoriasis.
21148331 Analyses of 164 RUNX1 mutations (RUNX1mut) in 147 of 449 patients (32.7%) with normal karyotype or noncomplex chromosomal imbalances were performed
21129147 results provide the first evidence that PF4 is regulated by RUNX1 and that impaired transcriptional regulation leads to the PF4 deficiency associated with RUNX1 haplodeficiency
21109770 TEL/AML1 may block AML1-mediated promotion of G1/S progression through the cell cycle; though TEL/AML1 is important for the (pre)leukemic clone development, it may be dispensable for leukemic cell survival
21090242 Downregulation of activated leukemic oncogenes AML1-ETO and RUNX1(K83N) expression with RNA-interference
21088106 genetic variation in RUNX1 and RUNX3 is associated with rectal cancer.
21088106 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21076613 Data suggest that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221.
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21059642 RUNX1 interacts with endogenous HDAC1 or HDAC3
21057539 elevated expression of EVI-1 was observed in basal subtype and was associated with poor outcome in estrogen receptor-negative breast cancer patients.
21054152 RUNX1-MTG16 fusion gene is associated with acute myeloblastic leukemia with t(16;21)(q24;q22).
21029724 These results suggest that mis-targeting of RAG proteins to recombination signal sequences within TEL and AML1 translocation regions might be responsible for the t(12;21)(p13;q22) chromosomal translocation not bearing Ig/TCR regions.
20970160 results indicate concurrent mechanisms in expression of MMP-2 and -9, RUNX1/AML1 and ETV5/ERM, and several basement membrane components, which likely associate with the invasive stage of endometrioid endometrial and ovarian endometrioid carcinoma.
20946940 Genetic variants in RUNX1 transcription factor are found in Down syndrome subjects who develop dementia of Alzheimer's disease.
20946940 Observational study of gene-disease association. (HuGE Navigator)
20880116 Observational study of gene-disease association. (HuGE Navigator)
20855863 High EVI-1 oncogene expression is associated with chronic-phase CML patients resistant to imatinib treated with second-generation tyrosine kinase inhibitors.
20846103 Data show that a nonsense mutation in exon 8 of germline RUNX1 mutation, which truncates the protein at amino acid 388.
20807887 TEL-AML1 might exert its antiapoptotic action at least in part by suppressing miRNA-494 and miRNA-320a, lowering their expression causing enhanced survivin expression.
20735389 RUNX1 rs2253319 is associated with adverse clinicopathological features and might be a prognostic factor for the recurrence of prostate-specific antigen in patients with prostate cancer radical prostatectomy.
20735389 Observational study of gene-disease association. (HuGE Navigator)
20722699 A novel RUNX1 mutation in a kindred with familial platelet disorder with propensity to acute myeloid leukaemia: male predominance of affected individuals.
20688956 Expression of AML1-ETO caused an expansion of hematopoietic precursors in Drosophila, which expressed high levels of reactive oxygen species
20686504 suppression of the AML1/MTG8 fusion gene was associated with severely reduced clonogenicity, induction of replicative senescence, impaired TERT expression and accelerated telomere shortening in acute lymphoblastic leukemia.
20682397 A 25-year-old man was admitted because of anemia and thrombocytopenia. Acute leukemia with t(1;21) and RUNX1 rearrangement could be associated with B/myeloid mixed phenotype.
20678218 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20589720 Studies indicate that RUNX1-repression independent activities may be equally important during leukemogenesis.
20547749 confirmed a role for Runx1 in mediating ER alpha genomic recruitment and regulation of tethering genes
20520637 expression of the C20orf112 and CBFA2T2 fusion genes is driven by the RUNX1 promoter sequence
20520634 Observational study of gene-disease association. (HuGE Navigator)
20506188 The interaction of RUNX1 with the SWI/SNF BRG1 and INI1 to control hematopoietic-specific gene expression is described.
20460523 Upregulation of POU4F1/BRN3A by AML1/ETO proteins is asssociated with t(8;21) acute myeloid leukemia.
20439113 RUNX1-ETO, which cannot associate with CBP, is unable to transactivate the GM-CSF promoter and is associated with the generation of a repressive chromatin environment at the promoter
20430957 Existence of an essential structural motif (hot spot) at the NHR2 dimer-tetramer interface, suitable for a molecular intervention in t(8;21) leukemias.
20421268 Observational study of gene-disease association. (HuGE Navigator)
20395453 AML1 enhances BLT1 expression by binding to AE-BLex, which is accessible in leukocytes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20339092 data identify NF-E2 as a novel AML1 target gene and delineate a role for aberrant AML1 expression in mediating elevated NF-E2 expression in patients with myeloproliferative neoplasms
20308320 Data suggest that Runx1 may act as a skin oncogene by directly promoting proliferation of the epithelial cells.
20306685 Studies show that FISH technic for the detection of CBF chromosomal aberrations was significantly higher than conventional cytogenetics.
20306249 The structural features of RUNX1/CBFbeta and their derivatives, their roles in transcriptional control, and their contributions to normal and malignant hematopoiesis are discussed. Review.
20206228 RUNX1 isoforms were differentially expressed during human embryonic stem cell embryoid body hematopoietic differentiation. RUNX1a & RUNX1b were expressed throughout hematopoietic differentiation, but RUNX1c only in definitive hematopoietic stem cells.
20197715 RUNX1 gene arrangement-positive group showed male predominance and younger age of onset than RUNX1 negative group by 1.6 yr.(RUNX1 protein, human)
20190817 Data link for the first time ETV6/RUNX1, mitotic checkpoind, and MAD2L1 and provide new insights into the function of the E/R fusion gene product.
20181616 ALOX12 is a direct transcriptional target of RUNX1.
20124335 RUNX1/RUNX1T1 rearrangement by cryptic insertion of the RUNX1 gene is associated with acute myeloid leukemia.
20111069 A novel alternatively spliced exon in AML1-ETO negatively influences the clonogenic potential of the t(8;21) in acute myeloid leukemia.
20035012 Compromising the C-terminal functions of Runx1 is a common mechanism for the pathological consequences of a variety of somatic mutations and Runx1-related leukemic fusion proteins observed in human patients.
20030931 nucb2 is the direct target gene of AML1 and AML1-ETO, the transcription regulation of AML1, AML1-ETO on nucb2 is carried out via repressing its promoter activity.
20008790 Stem cell exhaustion due to Runx1 deficiency is prevented by Evi5 activation in leukemogenesis.
20001241 Data show that the poor prognosis associated with RUNX1 amplification.
19998443 Cytogenetic study of 33 children with ETV6-RUNX1 positive acute lymphoblastic leukemia predict long term survival.
19946261 Novel RUNX1 mutations in familial platelet disorder with enhanced risk for acute myeloid leukemia.
19917773 Transcription factors RUNX1 and RUNX3 in the induction and suppressive function of Foxp3+ inducible regulatory T cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896186 CD9 expression can be used to predict childhood TEL/AML1-positive acute lymphoblastic leukemia.
19850737 Results indicate that AML1/RUNX1 point mutations may have a leukemogenic potential in MPN stem cells, and they may promote leukemic transformation in MPN.
19808697 RUNX1 mutations are associated with distinct biologic and clinical characteristics and poor prognosis in patients with de novo acute myeloid leukemia
19808697 Observational study of gene-disease association. (HuGE Navigator)
19773259 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19666867 RUNX1 mutation is associated with acute myeloid leukemia M0.
19665068 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19665068 This novel SNP array analysis in an extremely rare series of cases opens new ideas about the etiology of ETV6-RUNX1-positive ALL
19638627 RUNX1 may play a critical role in chemotherapy response in acute megakaryocytic leukemia by regulating the PI3-kinase/Akt pathway.
19626042 Site-directed mutagenesis showed that the predicted AML-1 site is essential for the regulation of CD160 gene expression.
19603429 REVIEW: RUNX3-mediated repression of RUNX1 in B cells
19581587 CalpainB is required for AML1-ETO-induced blood cell disorders in Drosophila.[AML1-ETO]
19524548 CHIP serves as an E3 ubiquitin ligase that regulates Runx1 protein stability via an ubiquitination and degradation mechanism that is independent of Hsp70/90.
19494111 TGFbeta stimulates Bim transcription by up-regulating the expression of the transcription factor Runx1 through an internal ribosome entry site -dependent mechanism.
19458628 AML1-ETO9a is correlated with C-KIT overexpression/mutations and indicates poor disease outcome in t(8;21) AML-M2.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19448675 Findings indicate a role for replication-independent pathways in RUNX and RUNX1-ETO senescence, and show that the context-specific oncogenic activity of RUNX1 fusion proteins is mirrored in their distinctive interactions with fail-safe responses.
19403666 Downregulation of RUNX1 by RUNX3 is required for EBV-driven B-cell proliferation.
19387465 study reports a female patient & her father who both developed myelodysplastic syndrome-related acute myeloid leukemia (MDR-AML) with differing clinical course caused by heterozygous germline mutation in RUNX1 & different secondary chromosomal aberrations
19357396 Although haploinsufficiency of RUNX1 causes familial platelet disorder, a second genetic event involving RUNX1 is often associated with progression to acute myeloid leukemia.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19337732 the Pro236LeufsX48 mutation must be seen as a predisposing factor for leukemogenesis hereditary thrombocytopenia
19334039 Review: Molecular pathways mediating myelodysplastic syndrome/acute myeloid leukemia with focus on AML1/RUNX1 point mutations.
19328795 The symplekin/ZONAB complex inhibits intestinal cell differentiation by the repression of AML1/Runx1.
19322702 Multiple evidence indicates that, in HNSCC cell lines, survivin inhibition by gene therapy and by small molecule inhibitors significantly increases the anti-tumour activity of several cytotoxic and other targeted therapies.
19282830 9 missense, 1 silent, 7 nonsense & 15 frameshift RUNX1 mutations were found in 30 chronic myelomonocytic leukemia patients: 23 in the N-terminal & 9 in the C-terminal region. The latter may be associated with more frequent & rapid AML transformation.
19282830 Observational study of gene-disease association. (HuGE Navigator)
19179469 CBFbeta is essential for TEL-AML1's ability to promote self-renewal of B cell precursors in vitro.
19167608 Marker chromosomes are a significant mechanism of high-level RUNX1 gene amplification in hematologic malignancies
19158815 Observational study of gene-disease association. (HuGE Navigator)
19151769 higher expression level of AML1a in acute lymphoblastic leukemia and acute myeloid leukemia M2 patients in comparison tocontrols; AML1a represses transcription of promoter of MCSFR mediated by AML1b, indicating that AML1a antagonized the effect of AML1b.
19144660 Observational study of gene-disease association. (HuGE Navigator)
19129484 Cytotoxic T cells sensitized with leukemic DC produced more IFN-gamma and TNF-alpha upon presentation of the TEL/AML1 peptide
19114653 miR-27a plays a regulatory role in megakaryocytic differentiation by attenuating Runx1 expression, and during megakaryopoiesis, Runx1 and miR-27a are engaged in a feedback loop involving positive regulation of miR-27a expression by Runx1.
19100516 ETV6/RUNX1 fusion lacking prognostic effect in pediatric patients with acute lymphoblastic leukemia.
19100510 Four copies of RUNX1 were found.
19043539 major role for the functional interaction of AML1/ETO with AML1 and HEB in transcriptional regulation determined by the fusion protein
19020999 Galectin-3 is regulated by RUNX1 and RUNX2 in human pituitary tumor cells by direct binding to the promoter region of LGALS3 and thus may contribute to pituitary tumor progression.
19001502 novel role for the leukemia-related AML1-ETO protein in epigenetic control of cell growth through upregulation of ribosomal gene transcription mediated by RNA Pol I.
18952841 crucial role of the NHR4 domain in determination of cellular fate during AML1-ETO-associated leukemogenesis.
18928518 For most patients, the presence of TEL-AML1 fusion gene at diagnosis of B-acute lymphoblastic leukemia suggests a favorable prognosis.[TEL-AML1 fusion protein]
18925961 mutations and gene rearrangements (including USP16-RUNX1 fusion) are detected in chronic myelomonocytic leukemia
18853425 Histone H1 depletion and/or histone H3 hyperacetylation may have a linkage with an increase susceptibility of specific chromosomal regions to undergo translocations.
18790797 Increased expression of p21/WAF/Cip1 in primary leukemic blasts suggests that elevated p21/WAF/Cip1 levels may contribute to specific features observed in AML1-positive leukemia.
18767146 genomic profile of ETV6-RUNX1 positive acute lymphoblastic leukemia highlights a recurrent deletion of TBL1XR1.
18767145 array CGH performed on CD34(+) cells revealed cryptic partial deletions of RUNX1.
18728978 hypothesis of the ETV6/RUNX1 leukemogenic model shows these secondary changes are necessary for leukemogenesis rather than progression of disease. This study also disclosed RUNX1 alterations in the ETV6/RUNX1-negative group
18724045 Considering these results, AML1 point mutations might be a useful biomarker that differentiates radio-induced MDS/AML from spontaneous MDS/AML.
18723428 It would appear prudent to screen young patients with myelodysplasia/AML for RUNX1 mutation, before consideration of sibling hematopoietic stem cell transplantation.
18695000 interaction with PEBP2-beta leads to the phosphorylation of RUNX1, which in turn induces p300 phosphorylation
18687690 AML1 can regulate the c-mpl promoter both positively and negatively by changing the binding partner according to cell types
18687517 survivin gene acts as a critical mediator of AML1/ETO-induced late oncogeneic events.
18671852 Gene expression profiling identified several biological pathways downstream of RUNX1 in patients with FPD-AML.
18668679 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18663147 RUNX3 is found to be commonly repressed by the t(8;21) and inv(16) fusion proteins and might have an important role in core-binding factor AML
18656694 RUNX1-MTG16 fusion gene in acute myeloblastic leukemia with t(16;21)(q24;q22) is reported.
18635414 TEL/AML1 fusion gene may have a role in childhood acute lymphoblastic leukemia
18622412 Fanconi Anemia patient with AML1 gene amplification and monosomy 7 in pre-transplant myelodysplasia (MDS) relapsing 7 years after successful allo-SCT.
18548094 RUNX1/RUNX1T1 siRNAs compromise the engraftment and/or self-renewal capacities of t(8;21) leukaemia-initiating cells.
18539581 Novel cytogenetic mutation typical for childhood B-cell ALL: intrachromosomal amplification of chromosome 21, which requires high-risk therapy irrespective of other risk factors and is associated with a cryptic 12;21 translocation of good prognostic value
18519037 AML1-ETO promotes leukemogenesis by blocking cell differentiation through inhibition of Sp1 transactivity.
18511808 AML1-ETO fusion proteins have a selective preference for certain AML1 target genes that contain multimerized AML1 consensus sites in their regulatory elements
18487507 role of RUNX1 haploinsufficiency in megakaryopoiesis and predisposition to AML; leukemic clone had trisomy 21 resulting from duplication of chromosome 21 containing the RUNX1 deletion
18478040 Point mutations to large genomic deletions of RUNX1 gene is associated with thrombocytopenia and mental retardation
18462252 study excludes occurrence and persistence of ETV6-RUNX1 transcript in most pregnancies between 6th and 10th week of development at levels of >/=10-4
18445843 Conclude that acute lymphoblastic leukemia TEL-AML1 gene status should be incorporated into risk classification schemes.
18337762 AML1-Evi-1 specifically transforms hematopoietic stem cells through fusion of the entire Evi-1 sequence to AML1.
18332109 In functional assays, corepressor ETO, but not AML1/ETO, augments SHARP-mediated repression in an histone deacetylase-dependent manner.
18328148 Data of the current study do not confirm the universal and population independent susceptibility role of the SLC22A4 C6607T and RUNX1 G24658C variants for rheumatoid arthritis.
18328148 Observational study of gene-disease association. (HuGE Navigator)
18316480 PRMT1- dependent methylation of RUNX1 at arginine residues 206 and 210 abrogates its association with SIN3A.
18276842 p19(INK4D) knockdown led to a moderate increase (31.7% +/- 5%) in the mean ploidy of megakaryocytes suggesting a role of p19(INK4D) in the endomitotic arrest.
18206548 RUNX1 rearrangements in acute myeloblastic leukemia relapsing after hematopoietic stem cell transplantation.
18206538 RUNX1 over-representation is associated to a poor outcome of acute lymphoblastic leukemia.
18202291 analysis of TEL-AML1-transduced cord blood cells suggests that TEL-AML1 functions as a first-hit mutation by endowing this preleukemic cell with altered self-renewal and survival properties
18202228 RUNX1 DNA-binding mutations and RUNX1-PRDM16 cryptic fusions in BCR-ABL+ leukemias are frequently associated with secondary trisomy 21 and may contribute to clonal evolution and imatinib resistance
18192504 C-terminal truncated AML1 mutant (S291fsX300) induced pancytopenia with erythroid dysplasia in transplanted mice, followed by progression to Myelodysplastic syndrome or acute myelogenous leukemia
18183572 VP-16 causes the ETO gene repositioning which allows AML1 and ETO genes to be localized in the same nuclear layer; data corroborate the so called "breakage first" model of the origins of recurrent reciprocal translocation
18166807 a heterozygous single nucleotide deletion in exon 8 of the RUNX1 gene may play a role in development of myeloid malignancies
18087673 RUNX1 gene single nucleotide polymorphism was associated with rheumatoid arthritis
18087673 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18003885 cdk phosphorylation of RUNX1 potentially couples stem/progenitor proliferation and lineage progression
17996649 miR-223 is a direct transcriptional target of AML1/ETO
17989718 constitutively and overexpressed AML1-ETO protein was cleaved to four fragments of 70, 49, 40 and 25 kDa by activated caspase-3 during apoptosis induction by extrinsic mitochondrial and death receptor signaling pathways.
17975013 AML1-ETO may facilitate accumulation of genetic alterations by suppressing endogenous DNA repair in acutet myeloid leukemia.
17956600 Gene expression analyses of leukemia cells from children with TEL/AML1-positive and -negative B-lineage ALL led to the identification of five biological processes.
17935781 Mutation of AML1 gene is associated with pediatric primary myelodysplastic syndrome and juvenile myelomonocytic leukemia
17910630 RUNX1 mutation is associated with poor prognosis in patients with primary myelodysplastic syndrome. It may play a role in the development and progression of a subset of primary myelodysplastic syndrome
17894555 Inhibition of C/EBPalpha function may be causatively related to the leukemogenic potential of RUNX1/EVI1 chimeric transcription factor.
17889714 RUNX1 may have a role in lineage conversion of childhood B-cell acute lymphoblastic leukemia to acute myelogenous leukemia [case report]
17889709 analysis of the prevalence of the ETV6-RUNX1 fusion gene in children with acute lymphoblastic leukemia in China
17854666 Disruption in the RUNX1 gene is associated with acute myeloid leukemia
17690704 ETV6/RUNX1-positive acute lymphoblastic leukemias have a high incidence of cryptic Xq duplications
17684492 Runx1 overexpression inhibited DNA-binding and transcriptional activity of HIF-1alpha.
17673463 c-MET is associated with FAS and when activated enhances drug-induced apoptosis in pediatric B acute lymphoblastic leukemia with TEL-AML1 translocation
17650443 Trisomy 13 patients with a RUNX1 mutation showed a 4-fold higher expression of FLT3 mRNA compared to controls.
17625612 AML1-ETO and JAK2 may have a role in leukemogenesis, as shown by a myeloproliferative syndrome progressing to acute myeloid leukemia [case report]
17589498 Monocytopoiesis is controlled by a circuitry involving sequentially miRNA 17-5p-20a-106a, AML1 and M-CSFR, whereby miRNA 17-5p-20a-106a function as a master gene complex interlinked with AML1 in a mutual negative feedback loop.
17560011 Presence of AML1-ETO fusion protein increases the susceptibility of cells to chemical carcinogens, which favors the development of additional genetic alterations.
17550866 AML1 mutations were identified in 6.3% of acute myeloid leukemia patients with chromosomal translocations involving CBF, PML-RARalpha, HOX, or ETS transcription factor (TF) gene families
17533375 transcription mediated by AML1 is impaired by mutations of the HIPK2 gene in acute myeloid leukemia and myelodysplastic syndrome
17532767 identified a novel RUNX1 fusion partner, LRP16 on 11q13 involving t(11;21)(q13;q22)
17485549 Trisomy 13 is strongly associated with AML1/RUNX1 mutations and increased FLT3 expression in acute myeloid leukemia
17394134 haploinsufficiency of RUNX1 is possible mechanism underlying disease progression in the 8p11 myeloproliferative syndrome
17377532 In natural T(R) cells, Foxp3 interacts physically with AML1
17285576 One of the chromosome bands most often involved in structural rearrangements in B-cell precursor acute lymphoblastic leukemia.
17234761 RUNX1 DNA-binding mutants antagonize Runx1 function in early progenitors by disrupting a critical balance between DNA-binding-independent and DNA-binding-dependent signaling.
17213321 integrate three key determinants of hematopoietic stem cell development; the Scl transcriptional network, Runx1 activity, and the Bmp4/Smad signaling pathway
17095626 functional relationship between TEL/AML1, HSP90, and survivin provides the rational for targeted therapy.
17079875 Observational study of gene-disease association. (HuGE Navigator)
17079875 Polymorphisms in RUNX1 might be one of the genetic factors for the regulation of IgE production.
17072347 a marked accumulation of AML1 transcripts including a high frequency of a novel alternatively spliced AML1b transcript lacking exon 6 (AML1b(Del179-242)) in ovarian cancer
17043020 Combined overexpression of RUNX1 and NCAM during stress hematopoiesis in Down syndrome might be a key factor in the development of overt leukemia.
17017876 This review reports the high incidence of somatic mutations in the AML1/RUNX1 gene, which is a critical regulator of definitive hematopoiesis and the most frequent target for translocation of AML in myelodysplastic syndrome.
17015828 TEL-AML1 fusion in transgenic zebrafish induces a B cell differentiation arrest and demonstrates leukemia development associated with loss of TEL expression and elevated Bcl2/Bax ratio.
16964375 RUNX1 is not involved in most cases of gastric cancers.
16914570 These results suggest that methylation profile may be a potential new biomarker of risk prediction in ETV6/RUNX1-positive acute lymphoblastic leukemias.
16892559 Isolation of 3 novel isoforms of AML 1 (RUNX1) with different transactivating function, that might be a regulatory element of the NCAM (CD56) overexpression in chronic myocardial ischemia.
16888092 Notch signaling may modulate both expression and transcriptional activity of Runx1
16821265 Observational study of gene-disease association. (HuGE Navigator)
16803898 an N-terminal transactivation domain of Runx1 separates molecular function from global differentiation function
16741927 Conditional expression of AML1-ETO by the ecdysone-inducible system dramatically increases the expression of connexin 43 together with growth arrest at G1 phase in leukemic U937 cells.
16684349 Our results suggest that mammalian RUNX family transcription factors are novel binding partners and substrates for the Pim-1 kinase, which may be able to regulate their activities during normal hematopoiesis as well as in leukemogenesis.
16674921 These results suggest that RUNX1 down-regulates terminal differentiation of megakaryocytes and promotes proliferation of megakaryocytic progenitors.
16673018 novel TEL-AML1 fusion in precursor B acute lymphoblastic leukemia
16652416 Observational study of gene-disease association. (HuGE Navigator)
16652416 the SLC22A4 and RUNX1 polymorphisms did not show a significant role in rheumatoid arthritis susceptibility in a Spanish population
16652147 The association between RUNX1, histone deacetylases and SUV39H1 provides a molecular mechanism for repression and possibly gene silencing mediated by RUNX1.
16652140 Suppression of AML1/MTG8 results in the increased expression of genes associated with myeloid differentiation, such as AZU1, BPI, CTSG, LYZ and RNASE2 as well as of antiproliferative genes such as IGFBP7, MS4A3 and SLA both in blasts and in cell lines
16628190 The physical interaction and synergy between GATA1 and RUNX1 are retained in DS-AMKL, although it is still possible that increased RUNX1 activity plays a role in the development of leukemia in DS.
16627249 8 mutations are in the runt domain; 1 in intron 3, & 2 in intron 5. Insertions of 3 AAs at c.416_417 & c.422_423 interfere with protein folding. The TTTAG duplication in intron 3 replaces the splice acceptor site with a premature stop codon.
16616331 Oligomerization is also required for AML1/ETO's interactions with ETO, MTGR1, and MTG16, but not with other corepressor molecules.
16598304 A 3' RACE experiments followed by sequence-specific RT-PCR resulted in the identification of the PRDM16 gene as a novel fusion partner of the RUNX1 gene in a patient with rare t(1;21)(p36;q22).
16519819 Observational study of gene-disease association. (HuGE Navigator)
16474840 fusion of AML1 with ETO or MTG16 exhibits reduced intranuclear mobility compared with wild-type AML1 or either fusion partner
16442267 KAP5 gene expression in human hair follicles is regulated by Runx1
16386788 The TCR gene rearrangements in childhood B-lineage acute lymphoblastic leukemia was associated with expression of AML1 chimeric oncogene.
16314494 Runx1 blocks the elongation by RNAPII, which may contribute to CD4 silencing during T-cell development.
16307024 AML1 positive patients characterized by significantly higher frequency of abnormalities involving long arm of chromosome 6 comparing with AML1 negative.
16287839 direct association of cyclin D3 with AML1 functions as a putative feedback mechanism to regulate cell cycle progression and differentiation
16278392 TEL-AML1 may have a role in T-cell receptor gene rearrangements in pediatric acute lymphoblastic leukemia
16249223 Observational study of gene-disease association. (HuGE Navigator)
16237704 RUNX factors participate in prostate epithelial cell function and cooperate with an Ets transcription factor to regulate PSA gene expression
16213368 TEL/AML1 rearrangement is not unique in childhood ALL, and cryptic TEL deletion without TEL/AML1 rearrangement was more frequent than the TEL/AML1 rearrangement in adult ALL.
16177090 Runx1 functions to suppress the apoptotic sensitivity of transgenic double-positive thymocytes in the context of TCR signaling.
16149049 Our results indicate that the NMTS region of Runx1 is required for functional interactions with PU.1.
16102112 the uPA gene contains a novel 13-bp palindrome that contains the DNA consensus-binding hexamer for RUNX1
15991223 Increased expression of AML1-a is associated with chromosomal abnormalities in childhood acute lymphoblastic leukemia
15970674 the mechanisms of drug sensitivity and resistance differs between TELAML1-positive ALL and other precursor B-lineage ALL patients.
15968309 Observational study of genetic testing. (HuGE Navigator)
15914564 human AML1/EVI1/+ knock-in mouse embryos showed defective hematopoiesis in the fetal liver; fetal liver contained multilineage progenitors capable of differentiating into dysplastic myelocyte and megakaryocyte
15856017 increased Runx1 dosage is leukemogenic in myeloid lineage
15829516 AML1 and ETO are fused together at the t8;21 translocation breakpoint, resulting in the expression of a chimeric protein called AML1-ETO, which acts as a constitutive transcriptional repressor.
15741216 a C-terminal AML1 mutation leads to a decrease in Mpl receptor expression in familial thrombocytopenia
15735013 Results suggest a novel mechanism for gene silencing mediated by RUNX1/MTG8 and support the combination of HDAC and DNMT inhibitors as a novel therapeutic approach for t(8;21) AML.
15728845 Transfected human Runx1 coordinates the proliferation and neuronal differentiation of selected populations of murine neural progenitors.
15723339 Alternative splicing in the AML1-MTG8 fusion gene occurs in leukemia cell lines as well as in cells of leukemia paatients with a(8;21) translocation
15705784 AML1-FOG2 and FOG2-AML1 are expressed in myelodysplastic syndrome; results suggest a central role for CtBP in AML1-FOG2 transcriptional repression and implicate coordinated disruption of AML1 and GATA developmental programs in the disease pathogenesis
15704129 Fusion witw ETV6 may provide circumstantial evidence of an increased risk of relapse in leukemia.
15688019 RUNX3 regulates RUNX1 expression in human B lymphoid cell lines.
15654961 Observational study of gene-disease association. (HuGE Navigator)
15618958 No point mutations of the AML1 gene were observed om acute myelocytic leukemia or myodisplastic syndromes.
15613106 Somatic point mutations in high-risk myelodysplastic syndrome, but not in myelofibrosis with myeloid metaplasia
15489901 AML1/ETO fusion protein exerts its function in transcriptional dysregulation in AML
15475366 the ERK family of protein kinases is activated by phorbol esters to phosphorylate the (S/T)P sites within the AML1c molecule and markedly enhance the transcriptional activity of AML1c
15386419 Expression of RUNX1 is down regulated in a significant portion of gastric cancer cases; may be involved in gastric carcinogenesis
15339695 Molecular diversity of the RUNX1 gene in phenotypically and cytogenetically similar cases ofmolecular diversity of the RUNX1 gene in phenotypically and cytogenetically similar cases of chronic myeloid leukemia.
15333839 study identifes E proteins as AML1-ETO targets whose dysregulation may be important for t(8;21) leukemogenesis
15203865 Present in acute myeloid leukemia of M2 subtype.
15184985 Review. A SNP in RUNX1 is significantly associated with with rheumatoid arthritis. It affects binding to the promoter of SLC22A4. It is possible that RUNX1 is a key molecule in autoimmunity.
15179033 Data show that the repressor activity of TEL/RUNX1 differs from that of TEL, even though both TEL and TEL/RUNX1 interact with the nuclear hormone co-repressor (N-CoR) and histone deacetylase (mSin3A) in vivo.
15142881 TEL-AML1 ALL has significantly lower de novo purine synthesis and differential expression of genes involved in purine metabolism.
15142876 AML1 mutations and deletion of genes on chromosome arm 7q cooperate in leukemogenesis and predispose to leukemic transformation.
15104290 we found an incidence of 8.6% of TEL/AML1 translocation in ALL patients (12% of B-lineage ALL)
15104277 chromosome 21 tandem repetition resulted in amplification of the AML1 gene in one case but in another case the AML1 gene was not included in the tandem repeat, showing that apparently similar cytogenetic aberrations may be different at the molecular level
15061191 REVIEW: Familial mutations predispose to acute myeloid leukemia
15051730 RUNX1 and RUNX2 regulate TIMP1 gene expression
14970218 NERF/ELF-2 physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene
14752096 acetylation of AML1 through p300 is a critical manner of posttranslational modification and identify a novel mechanism for regulating the function of AML1
14747476 AML1/RUNX1 increases during G1 to S cell cycle progression independent of cytokine-dependent phosphorylation and induces cyclin D3 gene expression
14623259 In conclusion, we provide evidence for AML-1, PU.1, and Sp3 cooperatively and directly mediating BPI-expression during myeloid differentiation.
14615365 AML1 point mutation is one of the major driving forces of myelodysplastic syndrome and acute myeloid leukemia, and these mutations may represent a distinct clinicopathologic-genetic entity.
14562119 reduced AML1 activities predispose cells to the acquisition of the activating FLT3 mutation as a secondary event leading to full transformation in acute myeloblastic leukemia M0.
14561740 RUNX1 binds to protein kinase C beta and is linked to a myeloid apoptotic pathway
14525764 heterozygous mutation (G>T) in intron 3 at the splice acceptor site for exon 4; this mutation is associated with not only thrombocytopenia, but also impaired platelet protein phosphorylation and GPIIb-IIIa activation
14523475 Amplification of this gene in childhood acute lymphoblsatic leukemia is associatd with poor outcome.
12937148 Strong overexpression of NCAM(CD56) and RUNX1(AML1) is a constant and characteristic feature of cardiomyocytes within or adjacent to scars in ICM.
12874780 In 241 patients with pediatric hematologic malignancies, AML1 mutations have been detected in seven patients (2.9%).
12773394 In t(8;21) leukaemic cells expressing the aberrant fusion protein AML1-ETO, we demonstrate that this protein is part of a transcription factor complex binding to extended sequences of the c-FMS intronic regulatory region rather than the promoter.
12760263 Oncogene AML-1 protein is detected frequently in acute myelogenous leukemia and it is a favorable prognostic factor in disease survival.
12699896 Double trisomy 8 and 21, one with rearrangement of the RUNX1 gene, in acute myelocytic leukemias
12643014 Review. AML1 plays a vital role in the regulation of expression of many genes involved in hematopoietic cell development, and the impairment of AML1 function disregulates the pathways leading to cellular proliferation and differentiation.
12604126 role in leukemogenesis
12576332 how RUNX1 might program divergence from the erythroid pathway to the megakaryocytic lineage commitment through functional and physical interactions with GATA-1
12560229 role in regulation of MIP-1 alpha expression in multiple myeloma
12557226 AML1 rearrangements leading to the AML1-ETO fusion gene are frequently the result of small hidden interstitial insertions.
12555067 identification as tumor suppressor gene
12554803 AML-1 plays a role in driving Mona protein expression in T and myelomonocytic cells.
12526921 Breakpoints in TEL intron 5 and AML1 intron 1 leading to TEL-AML1 fusion is shown to be the initiating step, preceding differentiation to pre-B cells, in childhood acute lymphoblastic leukemia.
12496475 30% of acute myeloid leukemia cases express a Core Binding Factor oncoprotein or harbor point mutations in one or both AML1 (RUNX1) genes.
12495904 review: genetics of CBFB and RUNX1 and roles in hematopoiesis and leukemogenesis, with emphasis on human and knockout mice studies
12393679 AML1 point mutations are related to low-dose radiation or alkylating agents and play a role distinct from that of leukemogenic chimeras; DNA binding ability and down-regulation of trans-activation of mutations
12393523 data demonstrate the capacity of AML1-ETO to promote the self-renewal of human hematopoietic cells and therefore support a causal role for t(8;21) translocations in leukemogenesis
12393286 AML1 amplification in a case of childhood acute lymphoblastic leukemia
12091359 the chromosomal translocation leads to formation of tel/aml1 fusion oncogene and is most common genetic aberration in childhood B-cell precursor ALL.
12082641 AML1 activates transcription genes critical for the G1 to S transition via its C-terminal transactivation domain. Inactivation of AML in acute leukemia is expected to slow proliferation unless additional alterations co-exist which accelerate G1.
12072207 A new translocation, t(4;21)(q21;q22) disrupting the AML1 gene was found in a case of childhood T-ALL.
12002768 REVIEW: In hematologic malignancies, point mutations of the AML1 gene present in the region encoding the Runt domain cause loss of the DNA-binding ability.
11986950 Potential involvement of the AML1-MTG8 fusion protein in the granulocytic maturation characteristic of the t(8;21) acute myelogenous leukemia cell
11979742 aml 1 gene chromosome translocation involves leukemia etiology
11921279 Mutations have been found in exons 3, 4, and 5 and in intron 4 of the AML1 gene in acute myeloid leukemia of FAB types M0 and M7.
11830488 mutant RUNX1 proteins (missense and nonsense) may also inhibit wild-type RUNX1, possibly creating a higher propensity to develop leukemia.
11792409 Runx1/AML1, a chromosome 21q22 hematopoietic regulator, is frequently translocated in leukemia

AA Sequence

MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF      1 - 70
LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS     71 - 140
GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR    141 - 210
VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA    211 - 280
SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY    281 - 350
HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP    351 - 420
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY                                         421 - 453
//

Text Mined References (523)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26990877 2016 MiR144/451 Expression Is Repressed by RUNX1 During Megakaryopoiesis and Disturbed by RUNX1/ETO.
26916619 2016 RUNX1 prevents oestrogen-mediated AXIN1 suppression and ?-catenin activation in ER-positive breast cancer.
26907657 2016 RUNX1 Amplification Increases the Risk for Thrombosis in Children With B-cell Acute Lymphoblastic Leukemia.
26901859 2016 Transcriptional Auto-Regulation of RUNX1 P1 Promoter.
26852652 2016 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26849013 2016 Genetic basis of myeloid transformation in familial platelet disorder/acute myeloid leukemia patients with haploinsufficient RUNX1 allele.
26745853 2016 RUNX1 haploinsufficiency results in granulocyte colony-stimulating factor hypersensitivity.
26716895 2016 miR-215 promotes malignant progression of gastric cancer by targeting RUNX1.
26706127 2016 Chaperonin TRiC/CCT Modulates the Folding and Activity of Leukemogenic Fusion Oncoprotein AML1-ETO.
26674644 2015 RUNX1-Evi-1 fusion gene inhibited differentiation and apoptosis in myelopoiesis: an in vivo study.
26671595 2015 t(15;21) translocations leading to the concurrent downregulation of RUNX1 and its transcription factor partner genes SIN3A and TCF12 in myeloid disorders.
26625756 2015 Low Frequency of ETV6-RUNX1 (t 12; 21) in Saudi Arabian Pediatric Acute Lymphoblastic Leukemia Patients: Association with Clinical Parameters and Early Remission.
26580584 2016 Alternative RUNX1 Promoter Regulation by Wnt/?-Catenin Signaling in Leukemia Cells and Human Hematopoietic Progenitors.
26580398 2015 A Double Negative Loop Comprising ETV6/RUNX1 and MIR181A1 Contributes to Differentiation Block in t(12;21)-Positive Acute Lymphoblastic Leukemia.
26546158 2016 Genome-wide studies identify a novel interplay between AML1 and AML1/ETO in t(8;21) acute myeloid leukemia.
26449661 2016 UBASH3B/Sts-1-CBL axis regulates myeloid proliferation in human preleukemia induced by AML1-ETO.
26418744 2015 Extrinsic and intrinsic signals converge on the Runx1/CBF? transcription factor for nonpeptidergic nociceptor maturation.
26320575 2015 Decoding of exon splicing patterns in the human RUNX1-RUNX1T1 fusion gene.
26316320 2016 Somatic mutations associated with leukemic progression of familial platelet disorder with predisposition to acute myeloid leukemia.
26237075 2015 Epigenetic landscape correlates with genetic subtype but does not predict outcome in childhood acute lymphoblastic leukemia.
26214902 IS THE AMPLIFICATION OF c-MYC, MLL AND RUNX1 GENES IN AML AND MDS PATIENTS WITH TRISOMY 8, 11 AND 21 A FACTOR FOR A CLONAL EVOLUTION IN THEIR KARYOTYPE?
26185316 2015 Heterogeneity of Abnormal RUNX1 Leading to Clinicopathologic Variations in Childhood B-Lymphoblastic Leukemia.
26175287 2015 Analyses of Genetic and Clinical Parameters for Screening Patients With Inherited Thrombocytopenia with Small or Normal-Sized Platelets.
26165925 2015 Runx1 Deficiency Decreases Ribosome Biogenesis and Confers Stress Resistance to Hematopoietic Stem and Progenitor Cells.
26161748 2015 The LMO2 -25 Region Harbours GATA2-Dependent Myeloid Enhancer and RUNX-Dependent T-Lymphoid Repressor Activity.
26021490 2015 Targeted gene correction of RUNX1 in induced pluripotent stem cells derived from familial platelet disorder with propensity to myeloid malignancy restores normal megakaryopoiesis.
26010396 2015 Loss of RUNX1/AML1 arginine-methylation impairs peripheral T cell homeostasis.
25911237 2015 RUNX1 represses the erythroid gene expression program during megakaryocytic differentiation.
25893288 2015 The TEL-AML1 fusion protein of acute lymphoblastic leukemia modulates IRF3 activity during early B-cell differentiation.
25879624 2015 Transcriptome sequencing reveals CHD1 as a novel fusion partner of RUNX1 in acute myeloid leukemia with t(5;21)(q21;q22).
25840971 2015 Biological Activities of RUNX1 Mutants Predict Secondary Acute Leukemia Transformation from Chronic Myelomonocytic Leukemia and Myelodysplastic Syndromes.
25801305 2015 New insights on the transcriptional regulation of CD69 gene through a potent enhancer located in the conserved non-coding sequence 2.
25656571 2015 rs11671784 G/A variation in miR-27a decreases chemo-sensitivity of bladder cancer by decreasing miR-27a and increasing the target RUNX-1 expression.
25612891 2015 miR-17 deregulates a core RUNX1-miRNA mechanism of CBF acute myeloid leukemia.
25596267 2015 ASXL1 mutations in younger adult patients with acute myeloid leukemia: a study by the German-Austrian Acute Myeloid Leukemia Study Group.
25575569 2015 Mutations in RAD21 disrupt regulation of APOB in patients with chronic intestinal pseudo-obstruction.
25562167 2014 MicroRNA-302b suppresses human epithelial ovarian cancer cell growth by targeting RUNX1.
25546363 2015 The RUNX1 +24 enhancer and P1 promoter identify a unique subpopulation of hematopoietic progenitor cells derived from human pluripotent stem cells.
25537508 2015 RUNX1, an androgen- and EZH2-regulated gene, has differential roles in AR-dependent and -independent prostate cancer.
25490895 2015 Level of RUNX1 activity is critical for leukemic predisposition but not for thrombocytopenia.
25486427 2015 LincRNA-uc002yug.2 involves in alternative splicing of RUNX1 and serves as a predictor for esophageal cancer and prognosis.
25452107 2015 MiR-18a increased the permeability of BTB via RUNX1 mediated down-regulation of ZO-1, occludin and claudin-5.
25388957 2015 Clonal origins of ETV6-RUNX1? acute lymphoblastic leukemia: studies in monozygotic twins.
25313057 2014 RUNX1 is essential for mesenchymal stem cell proliferation and myofibroblast differentiation.
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
25263451 2015 Posttranslational modifications of RUNX1 as potential anticancer targets.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25185713 2014 The Runx-PU.1 pathway preserves normal and AML/ETO9a leukemic stem cells.
25135298 2014 RUNX1-dependent RAG1 deposition instigates human TCR-? locus rearrangement.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
25114263 2014 Targeted correction of RUNX1 mutation in FPD patient-specific induced pluripotent stem cells rescues megakaryopoietic defects.
25101977 2014 The ordered acquisition of Class II and Class I mutations directs formation of human t(8;21) acute myelogenous leukemia stem cell.
25082877 2014 In adults with t(8;21)AML, posttransplant RUNX1/RUNX1T1-based MRD monitoring, rather than c-KIT mutations, allows further risk stratification.
25066867 2014 Frequent coexistence of RAS mutations in RUNX1-mutated acute myeloid leukemia in Arab Asian children.
25025858 2014 Expression of SP7, RUNX1, DLX5, and CTNNB1 in human mesenchymal stem cells cultured on xenogeneic bone substitute as compared with machined titanium.
24973361 2014 Frequent ASXL2 mutations in acute myeloid leukemia patients with t(8;21)/RUNX1-RUNX1T1 chromosomal translocations.
24972750 2015 Meta-analysis of SLC22A4 and RUNX1 polymorphisms : Associations with rheumatoid arthritis susceptibility.
24967588 2014 Expression of RUNX1 correlates with poor patient prognosis in triple negative breast cancer.
24897507 2015 Activating c-KIT mutations confer oncogenic cooperativity and rescue RUNX1/ETO-induced DNA damage and apoptosis in human primary CD34+ hematopoietic progenitors.
24792891 2014 RUNX1 point mutations potentially identify a subset of early immature T-cell acute lymphoblastic leukaemia that may originate from differentiated T-cells.
24783204 2014 RNA sequencing reveals upregulation of RUNX1-RUNX1T1 gene signatures in clear cell renal cell carcinoma.
24756106 2014 ERM/ETV5 and RUNX1/AML1 expression in endometrioid adenocarcinomas of endometrium and association with neoplastic progression.
24752773 2014 An intragenic long noncoding RNA interacts epigenetically with the RUNX1 promoter and enhancer chromatin DNA in hematopoietic malignancies.
24732596 2014 Impaired hematopoietic differentiation of RUNX1-mutated induced pluripotent stem cells derived from FPD/AML patients.
24727677 2014 Silencing AML1-ETO gene expression leads to simultaneous activation of both pro-apoptotic and proliferation signaling.
24716598 2015 Decreased expression of Runx1 and lowered proportion of Foxp3? CD25? CD4? regulatory T cells in systemic sclerosis.
24695740 2014 Runx1 regulation of Pu.1 corepressor/coactivator exchange identifies specific molecular targets for leukemia differentiation therapy.
24673627 2014 Whole transcriptome sequencing of a paediatric case of de novo acute myeloid leukaemia with del(5q) reveals RUNX1-USP42 and PRDM16-SKI fusion transcripts.
24651404 2014 Activation of HIV-1 from latent infection via synergy of RUNX1 inhibitor Ro5-3335 and SAHA.
24646888 2014 Structural basis of Ets1 activation by Runx1.
24616160 2014 Minimal residual disease monitoring in t(8;21) acute myeloid leukemia based on RUNX1-RUNX1T1 fusion quantification on genomic DNA.
24606315 2014 Mechanisms underlying platelet function defect in a pedigree with familial platelet disorder with a predisposition to acute myelogenous leukemia: potential role for candidate RUNX1 targets.
24523240 2014 Cooperativity of RUNX1 and CSF3R mutations in severe congenital neutropenia: a unique pathway in myeloid leukemogenesis.
24456692 2014 The AML1/ETO target gene LAT2 interferes with differentiation of normal hematopoietic precursor cells.
24449215 2014 Downregulation of RUNX1/CBF? by MLL fusion proteins enhances hematopoietic stem cell self-renewal.
24402164 2014 High number of additional genetic lesions in acute myeloid leukemia with t(8;21)/RUNX1-RUNX1T1: frequency and impact on clinical outcome.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24388988 2014 The long non-coding RNA H19-derived miR-675 modulates human gastric cancer cell proliferation by targeting tumor suppressor RUNX1.
24339741 2013 ETV6/RUNX1 induces reactive oxygen species and drives the accumulation of DNA damage in B cells.
24327541 2014 The role of topoisomerase II beta on breakage and proximity of RUNX1 to partner alleles RUNX1T1 and EVI1.
24321385 2014 Cohesin and CTCF differentially regulate spatiotemporal runx1 expression during zebrafish development.
24297870 2014 RUNX1 and NF-E2 upregulation is not specific for MPNs, but is seen in polycythemic disorders with augmented HIF signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240203 2014 Blocking ETV6/RUNX1-induced MDM2 overexpression by Nutlin-3 reactivates p53 signaling in childhood leukemia.
24130502 2013 Cooperation between RUNX1-ETO9a and novel transcriptional partner KLF6 in upregulation of Alox5 in acute myeloid leukemia.
24123676 2013 Identification of a novel fusion gene involving RUNX1 and the antisense strand of SV2B in a BCR-ABL1-positive acute leukemia.
24100448 2013 Enrichment of FLI1 and RUNX1 mutations in families with excessive bleeding and platelet dense granule secretion defects.
24055056 2013 Addiction of t(8;21) and inv(16) acute myeloid leukemia to native RUNX1.
24035334 2013 Characterization of bone marrow mast cells in acute myeloid leukemia with t(8;21) (q22;q22); RUNX1-RUNX1T1.
24007691 2013 Galectin-3 expression in pituitary adenomas as a marker of aggressive behavior.
24002588 2014 CBFB-MYH11/RUNX1 together with a compendium of hematopoietic regulators, chromatin modifiers and basal transcription factors occupies self-renewal genes in inv(16) acute myeloid leukemia.
23979164 2013 Transcription factor RUNX1 promotes survival of acute myeloid leukemia cells.
23958918 2014 Monitoring of residual disease by next-generation deep-sequencing of RUNX1 mutations can identify acute myeloid leukemia patients with resistant disease.
23874874 2013 Runx transcription factors repress human and murine c-Myc expression in a DNA-binding and C-terminally dependent manner.
23848403 2013 RUNX1, but not its familial platelet disorder mutants, synergistically activates PF4 gene expression in combination with ETS family proteins.
23753029 2013 In rare acute myeloid leukemia patients harboring both RUNX1 and NPM1 mutations, RUNX1 mutations are unusual in structure and present in the germline.
23741012 2013 STAT3 mediates oncogenic addiction to TEL-AML1 in t(12;21) acute lymphoblastic leukemia.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23528260 2013 Effects of c-KIT mutations on expression of the RUNX1/RUNX1T1 fusion transcript in t(8;21)-positive acute myeloid leukemia patients.
23527860 2013 Identification of a novel circularized transcript of the AML1 gene.
23488608 2013 The ETV6/RUNX1 fusion transcript is not detected in RNA isolated from neonatal dried blood spots from children later diagnosed with the corresponding leukemia.
23471304 2013 RUNX1/AML1 mutant collaborates with BMI1 overexpression in the development of human and murine myelodysplastic syndromes.
23443342 2013 Initially disadvantaged, TEL-AML1 cells expand and initiate leukemia in response to irradiation and cooperating mutations.
23442798 2013 The RUNX1 transcription factor is expressed in serous epithelial ovarian carcinoma and contributes to cell proliferation, migration and invasion.
23426948 2013 Attenuation of AML1-ETO cellular dysregulation correlates with increased leukemogenic potential.
23372166 2013 RUNX1a enhances hematopoietic lineage commitment from human embryonic stem cells and inducible pluripotent stem cells.
23352661 2013 RUNX1 is a key target in t(4;11) leukemias that contributes to gene activation through an AF4-MLL complex interaction.
23350231 [Transcription factor RUNX1].
23344057 2013 RUNX1: A microRNA hub in normal and malignant hematopoiesis.
23341344 2013 The molecular profile of adult T-cell acute lymphoblastic leukemia: mutations in RUNX1 and DNMT3A are associated with poor prognosis in T-ALL.
23327922 2013 Activity of a heptad of transcription factors is associated with stem cell programs and clinical outcome in acute myeloid leukemia.
23321257 2013 Prospective evaluation of gene mutations and minimal residual disease in patients with core binding factor acute myeloid leukemia.
23254331 2013 Novel function of the unique N-terminal region of RUNX1c in B cell growth regulation.
23223432 2013 Epigenetic silencing of microRNA-193a contributes to leukemogenesis in t(8;21) acute myeloid leukemia by activating the PTEN/PI3K signal pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175372 2013 Differential requirements for HIV-1 Vif-mediated APOBEC3G degradation and RUNX1-mediated transcription by core binding factor beta.
23148227 2013 Runt-related transcription factor 1 (RUNX1) stimulates tumor suppressor p53 protein in response to DNA damage through complex formation and acetylation.
23086478 2012 NOTCH1 promotes T cell leukemia-initiating activity by RUNX-mediated regulation of PKC-? and reactive oxygen species.
23065512 2013 Molecular similarity between myelodysplastic form of chronic myelomonocytic leukemia and refractory anemia with ring sideroblasts.
23034403 2012 Defining a tissue stem cell-driven Runx1/Stat3 signalling axis in epithelial cancer.
23028138 2012 Impact of an exercise intervention on DNA methylation in skeletal muscle from first-degree relatives of patients with type 2 diabetes.
22995345 2012 Transcription of the AML1/ETO chimera is guided by the P2 promoter of the AML1 gene in the Kasumi-1 cell line.
22919028 2012 Expression of the runt homology domain of RUNX1 disrupts homeostasis of hematopoietic stem cells and induces progression to myelodysplastic syndrome.
22898599 2012 Dysmegakaryopoiesis of FPD/AML pedigrees with constitutional RUNX1 mutations is linked to myosin II deregulated expression.
22865593 2012 Distinct genetic association at the PLCE1 locus with oesophageal squamous cell carcinoma in the South African population.
22828445 2013 EVI-1 modulates leukemogenic potential and apoptosis sensitivity in human acute lymphoblastic leukemia.
22777353 2013 Histone arginine methylation keeps RUNX1 target genes in an intermediate state.
22753902 2012 RUNX1 mutations are associated with poor outcome in younger and older patients with cytogenetically normal acute myeloid leukemia and with distinct gene and MicroRNA expression signatures.
22748822 2012 Expression of RUNX1 isoforms and its target gene BLK in childhood acute lymphoblastic leukemia.
22725134 2012 HIV type 1 viral infectivity factor and the RUNX transcription factors interact with core binding factor ? on genetically distinct surfaces.
22689681 2012 RUNX1 mutations in cytogenetically normal acute myeloid leukemia are associated with a poor prognosis and up-regulation of lymphoid genes.
22689058 2013 Functional characterization of the promoter region of the human EVI1 gene in acute myeloid leukemia: RUNX1 and ELK1 directly regulate its transcription.
22673192 2012 Functional interplay between p63 and p53 controls RUNX1 function in the transition from proliferation to differentiation in human keratinocytes.
22551552 2012 Runx1 deficiency in CD4+ T cells causes fatal autoimmune inflammatory lung disease due to spontaneous hyperactivation of cells.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22498736 2012 PRMT1 interacts with AML1-ETO to promote its transcriptional activation and progenitor cell proliferative potential.
22430633 2012 Elucidation of a novel pathogenomic mechanism using genome-wide long mate-pair sequencing of a congenital t(16;21) in a series of three RUNX1-mutated FPD/AML pedigrees.
22419089 Fragment of intron 5.2 of the human RUNX1 gene important for transcription activation is neither enhancer nor MAR-element.
22404039 2012 Genome-wide analysis of cytogenetic aberrations in ETV6/RUNX1-positive childhood acute lymphoblastic leukaemia.
22366949 2012 Reverse engineering of TLX oncogenic transcriptional networks identifies RUNX1 as tumor suppressor in T-ALL.
22343733 2012 Depletion of RUNX1/ETO in t(8;21) AML cells leads to genome-wide changes in chromatin structure and transcription factor binding.
22318203 2012 Functional features of RUNX1 mutants in acute transformation of chronic myeloid leukemia and their contribution to inducing murine full-blown leukemia.
22253733 2012 SARS coronavirus 3b accessory protein modulates transcriptional activity of RUNX1b.
22221250 2012 Amplified segment in the 'Down syndrome critical region' on HSA21 shared between Down syndrome and euploid AML-M0 excludes RUNX1, ERG and ETS2.
22201794 2012 RUNX1 and RUNX1-ETO: roles in hematopoiesis and leukemogenesis.
22163048 2011 Upregulation of the cell-cycle regulator RGC-32 in Epstein-Barr virus-immortalized cells.
22145956 2012 Systemic mastocytosis is uncommon in KIT D816V mutation positive core-binding factor acute myeloid leukemia.
22094587 2012 Silencing of ETV6/RUNX1 abrogates PI3K/AKT/mTOR signaling and impairs reconstitution of leukemia in xenografts.
22081516 2012 Mapping of homozygous deletions in verified esophageal adenocarcinoma cell lines and xenografts.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
22032690 2011 Metastatic breast cancer cells inhibit osteoblast differentiation through the Runx2/CBF?-dependent expression of the Wnt antagonist, sclerostin.
22028862 2011 The leukemia-specific fusion gene ETV6/RUNX1 perturbs distinct key biological functions primarily by gene repression.
22025082 2012 Submicroscopic deletion of RUNX1T1 gene confirmed by high-resolution microarray in acute myeloid leukemia with RUNX1/RUNX1T1 rearrangement.
22024923 2011 RUNX1 and its understudied role in breast cancer.
22021368 2011 AML1/RUNX1 functions as a cytoplasmic attenuator of NF-?B signaling in the repression of myeloid tumors.
22012064 2011 The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.
21900195 2011 ETV6-RUNX1 promotes survival of early B lineage progenitor cells via a dysregulated erythropoietin receptor.
21873977 2011 RUNX1 regulates the CD34 gene in haematopoietic stem cells by mediating interactions with a distal regulatory element.
21869842 2012 ETV6-RUNX1-positive childhood acute lymphoblastic leukemia: improved outcome with contemporary therapy.
21836608 2012 C-terminal mutation of RUNX1 attenuates the DNA-damage repair response in hematopoietic stem cells.
21836606 2012 PIG7, transactivated by AML1, promotes apoptosis and differentiation of leukemia cells with AML1-ETO fusion gene.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21828118 2011 Prognostic relevance of RUNX1 mutations in T-cell acute lymphoblastic leukemia.
21822204 2011 Pediatric B-lymphoblastic leukemia with RUNX1 amplification: clinicopathologic study of eight cases.
21803869 2011 RUNX transcription factors: association with pediatric asthma and modulated by maternal smoking.
21799513 2012 RUNX1-ETO deregulates the proliferation and growth factor responsiveness of human hematopoietic progenitor cells downstream of the myeloid transcription factor, MYCT1.
21764752 2011 The leukemogenicity of AML1-ETO is dependent on site-specific lysine acetylation.
21725049 2011 Down-regulation of the RUNX1-target gene NR4A3 contributes to hematopoiesis deregulation in familial platelet disorder/acute myelogenous leukemia.
21723253 2011 SERPINB13 is a novel RUNX1 target gene.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21640801 2011 Neuroblastoma cell proliferation is sensitive to changes in levels of RUNX1 and RUNX3 protein.
21576367 2011 A Runx1-Smad6 rheostat controls Runx1 activity during embryonic hematopoiesis.
21571218 2011 Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.
21518930 2011 RUNX1 regulates corepressor interactions of PU.1.
21493867 2011 The transcription factor evi-1 is overexpressed, promotes proliferation, and is prognostically unfavorable in infratentorial ependymomas.
21447743 2011 Repression of vascular endothelial growth factor expression by the runt-related transcription factor 1 in acute myeloid leukemia.
21445863 2011 Transcriptional regulation and spatial organisation of the human AML1/RUNX1 gene.
21380778 2012 Identification of a new translocation that disrupts the RUNX1 gene in a patient with de novo acute myeloid leukemia.
21343560 2011 RUNX1 mutations in acute myeloid leukemia: results from a comprehensive genetic and clinical analysis from the AML study group.
21332713 2011 RUNX1 mutations are rare in chronic phase polycythaemia vera.
21325596 2011 Myelodysplasia and leukemia of Fanconi anemia are associated with a specific pattern of genomic abnormalities that includes cryptic RUNX1/AML1 lesions.
21322790 2011 Forced Runx1 expression in human neural stem/progenitor cells transplanted to the rat dorsal root ganglion cavity results in extensive axonal growth specifically from spinal cord-derived neurospheres.
21294243 2011 AML1/RUNX1 gene point mutations in childhood myeloid malignancies.
21292764 2011 Down-regulation of Runx1 expression by TCR signal involves an autoregulatory mechanism and contributes to IL-2 production.
21283084 2011 The inv(3)(q21q26)/t(3;3)(q21;q26) is frequently accompanied by alterations of the RUNX1, KRAS and NRAS and NF1 genes and mediates adverse prognosis both in MDS and in AML: a study in 39 cases of MDS or AML.
21268063 2011 Molecular mechanisms that produce secondary MDS/AML by RUNX1/AML1 point mutations.
21252065 2011 Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1.
21233836 2011 An accumulation of cytogenetic and molecular genetic events characterizes the progression from MDS to secondary AML: an analysis of 38 paired samples analyzed by cytogenetics, molecular mutation analysis and SNP microarray profiling.
21224468 2011 ETV6/RUNX1-positive relapses evolve from an ancestral clone and frequently acquire deletions of genes implicated in glucocorticoid signaling.
21204219 2011 De Novo 21q22.1q22.2 deletion including RUNX1 mimicking a congenital infection.
21200020 2011 N-Ras(G12D) induces features of stepwise transformation in preleukemic human umbilical cord blood cultures expressing the AML1-ETO fusion gene.
21179004 2011 Differential genomic targeting of the transcription factor TAL1 in alternate haematopoietic lineages.
21166663 2011 Abnormality of RUNX1 signal transduction in psoriatic CD34+ bone marrow cells.
21148331 2011 RUNX1 mutations are frequent in de novo AML with noncomplex karyotype and confer an unfavorable prognosis.
21129147 2011 Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4.
21109770 2011 Revealing the role of TEL/AML1 for leukemic cell survival by RNAi-mediated silencing.
21090242 [Downregulation of activated leukemic oncogenes AML1-ETO and RUNX1(K83N) expression with RNA-interference].
21088106 2011 Associations between genetic variation in RUNX1, RUNX2, RUNX3, MAPK1 and eIF4E and riskof colon and rectal cancer: additional support for a TGF-?-signaling pathway.
21076613 2010 Down-regulation of microRNAs 222/221 in acute myelogenous leukemia with deranged core-binding factor subunits.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
21059642 2011 Phosphorylation of RUNX1 by cyclin-dependent kinase reduces direct interaction with HDAC1 and HDAC3.
21057539 2011 Control of EVI-1 oncogene expression in metastatic breast cancer cells through microRNA miR-22.
21054152 2011 RUNX1-MTG16 fusion gene in de novo acute myeloblastic leukemia with t(16;21)(q24;q22).
21029724 2010 RAG-dependent recombination at cryptic RSSs within TEL-AML1 t(12;21)(p13;q22) chromosomal translocation region.
20970160 2011 Matrix metalloproteinase-2 and matrix metalloproteinase-9 codistribute with transcription factors RUNX1/AML1 and ETV5/ERM at the invasive front of endometrial and ovarian carcinoma.
20946940 2011 Association of variants within APOE, SORL1, RUNX1, BACE1 and ALDH18A1 with dementia in Alzheimer's disease in subjects with Down syndrome.
20880116 2010 ASXL1 mutation is associated with poor prognosis and acute transformation in chronic myelomonocytic leukaemia.
20855863 2010 EVI-1 oncogene expression predicts survival in chronic-phase CML patients resistant to imatinib treated with second-generation tyrosine kinase inhibitors.
20846103 2010 Identification and molecular characterization of a novel 3&#x2032; mutation in RUNX1 in a family with familial platelet disorder.
20807887 2010 TEL-AML1 regulation of survivin and apoptosis via miRNA-494 and miRNA-320a.
20735389 2011 Clinical significance of runt-related transcription factor 1 polymorphism in prostate cancer.
20722699 2010 A novel RUNX1 mutation in a kindred with familial platelet disorder with propensity to acute myeloid leukaemia: male predominance of affected individuals.
20688956 2010 Genetic manipulation of AML1-ETO-induced expansion of hematopoietic precursors in a Drosophila model.
20686504 2010 Leukemic fusion genes MLL/AF4 and AML1/MTG8 support leukemic self-renewal by controlling expression of the telomerase subunit TERT.
20682397 2010 Therapy-related, mixed phenotype acute leukemia with t(1;21)(p36;q22) and RUNX1 rearrangement.
20678218 2010 Combined mutations of ASXL1, CBL, FLT3, IDH1, IDH2, JAK2, KRAS, NPM1, NRAS, RUNX1, TET2 and WT1 genes in myelodysplastic syndromes and acute myeloid leukemias.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20589720 2010 RUNX1 repression-independent mechanisms of leukemogenesis by fusion genes CBFB-MYH11 and AML1-ETO (RUNX1-RUNX1T1).
20547749 2010 Genome-wide analysis of estrogen receptor alpha DNA binding and tethering mechanisms identifies Runx1 as a novel tethering factor in receptor-mediated transcriptional activation.
20520637 2010 CBFA2T2 and C20orf112: two novel fusion partners of RUNX1 in acute myeloid leukemia.
20520634 2010 Mutation analysis for RUNX1, MLL-PTD, FLT3-ITD, NPM1 and NRAS in 269 patients with MDS or secondary AML.
20506188 2010 The human SWI/SNF complex associates with RUNX1 to control transcription of hematopoietic target genes.
20460523 2010 AML1/ETO proteins control POU4F1/BRN3A expression and function in t(8;21) acute myeloid leukemia.
20439113 2010 Transcriptional and epigenetic regulation of the GM-CSF promoter by RUNX1.
20430957 2010 Dimer-tetramer transition controls RUNX1/ETO leukemogenic activity.
20421268 2010 Transcription factor mutations in myelodysplastic/myeloproliferative neoplasms.
20395453 2010 AML1 enhances the expression of leukotriene B4 type-1 receptor in leukocytes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20339092 2010 AML1 is overexpressed in patients with myeloproliferative neoplasms and mediates JAK2V617F-independent overexpression of NF-E2.
20308320 2010 Runx1 directly promotes proliferation of hair follicle stem cells and epithelial tumor formation in mouse skin.
20306685 2008 Dual color FISH on CBF primary acute myeloid leukemia.
20306249 2010 Proleukemic RUNX1 and CBFbeta mutations in the pathogenesis of acute leukemia.
20206228 2010 Runx1 isoforms show differential expression patterns during hematopoietic development but have similar functional effects in adult hematopoietic stem cells.
20197715 2010 [Prognostic significance of TEL/AML1 rearrangement and its additional genetic changes in Korean childhood precursor B-acute lymphoblastic leukemia].
20190817 2010 ETV6/RUNX1 abrogates mitotic checkpoint function and targets its key player MAD2L1.
20181616 2010 RUNX1/core binding factor A2 regulates platelet 12-lipoxygenase gene (ALOX12): studies in human RUNX1 haplodeficiency.
20124335 2010 Acute myeloid leukemia with del(X)(p21) and cryptic RUNX1/RUNX1T1 from ins(8;21)(q22;q22q22) revealed by atypical FISH signals.
20111069 2010 A novel exon in AML1-ETO negatively influences the clonogenic potential of the t(8;21) in acute myeloid leukemia.
20096094 2010 Brn3a regulates neuronal subtype specification in the trigeminal ganglion by promoting Runx expression during sensory differentiation.
20035012 2010 Definitive hematopoiesis requires Runx1 C-terminal-mediated subnuclear targeting and transactivation.
20030931 2009 [Influence of AML1 and AML1-ETO on transcriptional regulation of nucb2 gene].
20008790 2010 Stem cell exhaustion due to Runx1 deficiency is prevented by Evi5 activation in leukemogenesis.
20001241 2010 RUNX1 amplification in B-cell acute lymphoblastic leukemia.
19998443 2010 Cytogenetics of long-term survivors of ETV6-RUNX1 fusion positive acute lymphoblastic leukemia.
19946261 2010 Novel RUNX1 mutations in familial platelet disorder with enhanced risk for acute myeloid leukemia: clues for improved identification of the FPD/AML syndrome.
19917773 2009 Transcription factors RUNX1 and RUNX3 in the induction and suppressive function of Foxp3+ inducible regulatory T cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896186 2010 CD9 expression can be used to predict childhood TEL/AML1-positive acute lymphoblastic leukemia: proposal for an accelerated diagnostic flowchart.
19850737 2009 AML1/RUNX1 point mutation possibly promotes leukemic transformation in myeloproliferative neoplasms.
19808697 2009 AML1/RUNX1 mutations in 470 adult patients with de novo acute myeloid leukemia: prognostic implication and interaction with other gene alterations.
19773259 2009 Genome wide molecular analysis of minimally differentiated acute myeloid leukemia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19666867 2009 Gene expression profiling of minimally differentiated acute myeloid leukemia: M0 is a distinct entity subdivided by RUNX1 mutation status.
19665068 2009 ETV6-RUNX1 fusion gene and additional genetic changes in infant leukemia: a genome-wide analysis.
19638627 2009 RUNX1 regulates phosphoinositide 3-kinase/AKT pathway: role in chemotherapy sensitivity in acute megakaryocytic leukemia.
19626042 2009 Identification and analysis of the human CD160 promoter: implication of a potential AML-1 binding site in promoter activation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19603429 2009 RUNX3-mediated repression of RUNX1 in B cells.
19581587 2009 A Drosophila model identifies calpains as modulators of the human leukemogenic fusion protein AML1-ETO.
19524548 2009 CHIP functions an E3 ubiquitin ligase of Runx1.
19494111 2009 Runx1 is a co-activator with FOXO3 to mediate transforming growth factor beta (TGFbeta)-induced Bim transcription in hepatic cells.
19458628 2009 AML1-ETO9a is correlated with C-KIT overexpression/mutations and indicates poor disease outcome in t(8;21) acute myeloid leukemia-M2.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19448675 2009 RUNX1 and its fusion oncoprotein derivative, RUNX1-ETO, induce senescence-like growth arrest independently of replicative stress.
19403666 2009 Downregulation of RUNX1 by RUNX3 requires the RUNX3 VWRPY sequence and is essential for Epstein-Barr virus-driven B-cell proliferation.
19387465 2009 A novel pedigree with heterozygous germline RUNX1 mutation causing familial MDS-related AML: can these families serve as a multistep model for leukemic transformation?
19357396 2009 High frequency of RUNX1 biallelic alteration in acute myeloid leukemia secondary to familial platelet disorder.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19337732 2009 Hereditary thrombocytopenia and acute myeloid leukemia: a common link due to a germline mutation in the AML1 gene.
19334039 2009 Molecular pathways mediating MDS/AML with focus on AML1/RUNX1 point mutations.
19328795 2009 The symplekin/ZONAB complex inhibits intestinal cell differentiation by the repression of AML1/Runx1.
19322702 2010 Survivin multifaceted activity in head and neck carcinoma: current evidence and future therapeutic challenges.
19282830 2009 RUNX1 mutations are frequent in chronic myelomonocytic leukemia and mutations at the C-terminal region might predict acute myeloid leukemia transformation.
19202074 2009 Transforming activity of AML1-ETO is independent of CBFbeta and ETO interaction but requires formation of homo-oligomeric complexes.
19179469 2009 CBFbeta is critical for AML1-ETO and TEL-AML1 activity.
19167608 2009 Marker chromosomes are a significant mechanism of high-level RUNX1 gene amplification in hematologic malignancies.
19158815 2009 Two-stage case-control association study of polymorphisms in rheumatoid arthritis susceptibility genes with schizophrenia.
19151769 2009 Overexpression of an isoform of AML1 in acute leukemia and its potential role in leukemogenesis.
19144660 2009 Frequent genomic abnormalities in acute myeloid leukemia/myelodysplastic syndrome with normal karyotype.
19129484 2009 Histone deacetylase inhibition improves differentiation of dendritic cells from leukemic blasts of patients with TEL/AML1-positive acute lymphoblastic leukemia.
19114653 2009 A regulatory interplay between miR-27a and Runx1 during megakaryopoiesis.
19100516 2009 ETV6/RUNX1 fusion lacking prognostic effect in pediatric patients with acute lymphoblastic leukemia.
19100510 2009 Duplication and triplication of der(21)t(8;21)(q22;q22) in acute myeloid leukemia.
19043539 2008 AML1/ETO oncoprotein is directed to AML1 binding regions and co-localizes with AML1 and HEB on its targets.
19020999 2009 RUNX1 and RUNX2 upregulate Galectin-3 expression in human pituitary tumors.
19001502 2008 The leukemogenic t(8;21) fusion protein AML1-ETO controls rRNA genes and associates with nucleolar-organizing regions at mitotic chromosomes.
18952841 2008 Disruption of the NHR4 domain structure in AML1-ETO abrogates SON binding and promotes leukemogenesis.
18928518 2008 Persistence of TEL-AML1 fusion gene as minimal residual disease has no additive prognostic value in CD 10 positive B-acute lymphoblastic leukemia: a FISH study.
18925961 2008 Genome profiling of chronic myelomonocytic leukemia: frequent alterations of RAS and RUNX1 genes.
18853425 2009 Altered chromatin modifications in AML1/RUNX1 breakpoint regions involved in (8;21) translocation.
18790797 2008 Transcriptional upregulation of p21/WAF/Cip1 in myeloid leukemic blasts expressing AML1-ETO.
18767146 2008 The complex genomic profile of ETV6-RUNX1 positive acute lymphoblastic leukemia highlights a recurrent deletion of TBL1XR1.
18767145 2008 Cryptic and partial deletions of PRDM16 and RUNX1 without t(1;21)(p36;q22) and/or RUNX1-PRDM16 fusion in a case of progressive chronic myeloid leukemia: a complex chromosomal rearrangement of underestimated frequency in disease progression?
18728978 2008 RUNX1 aberrations in ETV6/RUNX1-positive and ETV6/RUNX1-negative patients: its hemato-pathological and prognostic significance in a large cohort (619 cases) of ALL.
18724045 2008 High frequency of AML1/RUNX1 point mutations in radiation-associated myelodysplastic syndrome around Semipalatinsk nuclear test site.
18723428 2008 Five new pedigrees with inherited RUNX1 mutations causing familial platelet disorder with propensity to myeloid malignancy.
18695000 2008 PEBP2-beta/CBF-beta-dependent phosphorylation of RUNX1 and p300 by HIPK2: implications for leukemogenesis.
18687690 2008 AML1/RUNX1 works as a negative regulator of c-Mpl in hematopoietic stem cells.
18687517 2008 AML1/ETO-induced survivin expression inhibits transcriptional regulation of myeloid differentiation.
18671852 2008 Integrative analysis of RUNX1 downstream pathways and target genes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18668679 2008 Runt-related transcription factor 3 is associated with ulcerative colitis and shows epistasis with solute carrier family 22, members 4 and 5.
18663147 2008 Transcriptional repression of the RUNX3/AML2 gene by the t(8;21) and inv(16) fusion proteins in acute myeloid leukemia.
18656694 2008 RUNX1-MTG16 fusion gene in acute myeloblastic leukemia with t(16;21)(q24;q22): case report and review of the literature.
18635414 2008 TEL/AML1 fusion gene in childhood acute lymphoblastic leukemia in southern Taiwan.
18622412 2008 Fanconi Anemia patient with AML1 gene amplification and monosomy 7 in pre-transplant myelodysplasia (MDS) relapsing 7 years after successful allo-SCT.
18548094 2009 Transient depletion of RUNX1/RUNX1T1 by RNA interference delays tumour formation in vivo.
18539581 2008 [Intrachromosomal amplification of AML1 gene in childhood acute lymphoblastic leukemia].
18519037 2008 AML1-ETO interacts with Sp1 and antagonizes Sp1 transactivity through RUNT domain.
18511808 2008 t(8;21)(q22;q22) Fusion proteins preferentially bind to duplicated AML1/RUNX1 DNA-binding sequences to differentially regulate gene expression.
18487507 2008 Syndromic thrombocytopenia and predisposition to acute myelogenous leukemia caused by constitutional microdeletions on chromosome 21q.
18478040 2008 Clinical phenotype of germline RUNX1 haploinsufficiency: from point mutations to large genomic deletions.
18462252 2008 ETV6-RUNX1 transcript is not frequent in early human haematopoiesis.
18445843 2008 Prospective analysis of TEL gene rearrangements in childhood acute lymphoblastic leukemia: a Children's Oncology Group study.
18337762 2008 AML1-Evi-1 specifically transforms hematopoietic stem cells through fusion of the entire Evi-1 sequence to AML1.
18332109 2008 ETO, but not leukemogenic fusion protein AML1/ETO, augments RBP-Jkappa/SHARP-mediated repression of notch target genes.
18328148 No influence of SLC22A4 C6607T and RUNX1 G24658C genotypic variants on the circulating carnitine ester profile in patients with rheumatoid arthritis.
18316480 2008 Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity.
18280240 2008 Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.
18276842 2008 P19INK4D links endomitotic arrest and megakaryocyte maturation and is regulated by AML-1.
18206548 2008 RUNX1 rearrangements in acute myeloblastic leukemia relapsing after hematopoietic stem cell transplantation.
18206538 2008 Multiple copies of RUNX1: description of 14 new patients, follow-up, and a review of the literature.
18202291 2008 Initiating and cancer-propagating cells in TEL-AML1-associated childhood leukemia.
18202228 2008 RUNX1 DNA-binding mutations and RUNX1-PRDM16 cryptic fusions in BCR-ABL+ leukemias are frequently associated with secondary trisomy 21 and may contribute to clonal evolution and imatinib resistance.
18192504 2008 AML1 mutations induced MDS and MDS/AML in a mouse BMT model.
18183572 2008 Repositioning of ETO gene in cells treated with VP-16, an inhibitor of DNA-topoisomerase II.
18166807 2008 A novel RUNX1 mutation in familial platelet disorder with propensity to develop myeloid malignancies.
18087673 2008 Replication of reported genetic associations of PADI4, FCRL3, SLC22A4 and RUNX1 genes with rheumatoid arthritis: results of an independent Japanese population and evidence from meta-analysis of East Asian studies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003885 2008 Cyclin-dependent kinase phosphorylation of RUNX1/AML1 on 3 sites increases transactivation potency and stimulates cell proliferation.
17996649 2007 Epigenetic silencing of the myelopoiesis regulator microRNA-223 by the AML1/ETO oncoprotein.
17989718 2008 Multi-sites cleavage of leukemogenic AML1-ETO fusion protein by caspase-3 and its contribution to increased apoptotic sensitivity.
17975013 2008 p53 signaling in response to increased DNA damage sensitizes AML1-ETO cells to stress-induced death.
17956600 2007 Five distinct biological processes and 14 differentially expressed genes characterize TEL/AML1-positive leukemia.
17935781 2008 Mutation analysis of AML1 gene in pediatric primary myelodysplastic syndrome and juvenile myelomonocytic leukemia.
17910630 2007 RUNX1 gene mutation in primary myelodysplastic syndrome--the mutation can be detected early at diagnosis or acquired during disease progression and is associated with poor outcome.
17894555 2007 RUNX1/EVI1, which blocks myeloid differentiation, inhibits CCAAT-enhancer binding protein alpha function.
17889714 2007 RUNX1 amplification in lineage conversion of childhood B-cell acute lymphoblastic leukemia to acute myelogenous leukemia.
17889709 2007 Prevalence of ETV6-RUNX1 fusion gene in children with acute lymphoblastic leukemia in China.
17854666 2007 Two novel translocations disrupt the RUNX1 gene in acute myeloid leukemia.
17690704 2007 Combined high-resolution array-based comparative genomic hybridization and expression profiling of ETV6/RUNX1-positive acute lymphoblastic leukemias reveal a high incidence of cryptic Xq duplications and identify several putative target genes within the commonly gained region.
17684492 2008 Physical and functional interaction of Runt-related protein 1 with hypoxia-inducible factor-1alpha.
17673463 2007 Hepatocyte growth factor receptor c-MET is associated with FAS and when activated enhances drug-induced apoptosis in pediatric B acute lymphoblastic leukemia with TEL-AML1 translocation.
17650443 2007 Trisomy 13 correlates with RUNX1 mutation and increased FLT3 expression in AML-M0 patients.
17625612 2007 AML1-ETO meets JAK2: clinical evidence for the two hit model of leukemogenesis from a myeloproliferative syndrome progressing to acute myeloid leukemia.
17589498 2007 MicroRNAs 17-5p-20a-106a control monocytopoiesis through AML1 targeting and M-CSF receptor upregulation.
17560011 2007 Leukemogenic AML1-ETO fusion protein increases carcinogen-DNA adduct formation with upregulated expression of cytochrome P450-1A1 gene.
17550866 2007 AML1 mutation and its coexistence with different transcription factor gene families in de novo acute myeloid leukemia (AML): redundancy or synergism.
17533375 2007 Mutations of the HIPK2 gene in acute myeloid leukemia and myelodysplastic syndrome impair AML1- and p53-mediated transcription.
17532767 2007 LRP16 is fused to RUNX1 in monocytic leukemia cell line with t(11;21)(q13;q22).
17485549 2007 Trisomy 13 is strongly associated with AML1/RUNX1 mutations and increased FLT3 expression in acute myeloid leukemia.
17431401 2007 Cdk6 blocks myeloid differentiation by interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction.
17394134 2007 Fusion gene-mediated truncation of RUNX1 as a potential mechanism underlying disease progression in the 8p11 myeloproliferative syndrome.
17377532 2007 Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.
17285576 2007 Cytogenetic patterns in ETV6/RUNX1-positive pediatric B-cell precursor acute lymphoblastic leukemia: A Nordic series of 245 cases and review of the literature.
17234761 2007 RUNX1 DNA-binding mutants, associated with minimally differentiated acute myelogenous leukemia, disrupt myeloid differentiation.
17213321 2007 The SCL transcriptional network and BMP signaling pathway interact to regulate RUNX1 activity.
17095626 2007 RNAi-mediated silencing of TEL/AML1 reveals a heat-shock protein- and survivin-dependent mechanism for survival.
17079875 2006 Putative association of RUNX1 polymorphisms with IgE levels in a Korean population.
17072347 2007 Identification of a novel splice variant of AML1b in ovarian cancer patients conferring loss of wild-type tumor suppressive functions.
17043020 2006 Concomitant aberrant overexpression of RUNX1 and NCAM in regenerating bone marrow of myeloid leukemia of Down's syndrome.
17017876 2006 Implications of somatic mutations in the AML1/RUNX1 gene in myelodysplastic syndrome (MDS): future molecular therapeutic directions for MDS.
17015828 2006 TEL-AML1 transgenic zebrafish model of precursor B cell acute lymphoblastic leukemia.
16964375 2006 Expression status of RUNX1/AML1 in normal gastric epithelium and its mutational analysis in microdissected gastric cancer cells.
16917507 2006 Roles of HIPK1 and HIPK2 in AML1- and p300-dependent transcription, hematopoiesis and blood vessel formation.
16914570 2006 CpG island methylator phenotype redefines the prognostic effect of t(12;21) in childhood acute lymphoblastic leukemia.
16892559 2004 [The overexpression of NCAM (CD56) in human hearts is specific for ischemic damage].
16888092 2006 AML1/Runx1 rescues Notch1-null mutation-induced deficiency of para-aortic splanchnopleural hematopoiesis.
16858696 2006 Identification of novel Runx1 (AML1) translocation partner genes SH3D19, YTHDf2, and ZNF687 in acute myeloid leukemia.
16821265 2006 SLC22A4, RUNX1, and SUMO4 polymorphisms are not associated with rheumatoid arthritis: a case-control study in a Spanish population.
16803898 2006 Identification of an N-terminal transactivation domain of Runx1 that separates molecular function from global differentiation function.
16741927 2006 Leukemogenic AML1-ETO fusion protein upregulates expression of connexin 43: the role in AML 1-ETO-induced growth arrest in leukemic cells.
16684349 2006 Pim-1 kinase phosphorylates RUNX family transcription factors and enhances their activity.
16674921 2006 RUNX1 suppression induces megakaryocytic differentiation of UT-7/GM cells.
16673018 2006 A novel TEL-AML1 fusion transcript involving the pro-apoptotic gene BCL-G in pediatric precursor B acute lymphoblastic leukemia.
16652416 2006 Role of SLC22A4, SLC22A5, and RUNX1 genes in rheumatoid arthritis.
16652147 2006 RUNX1 associates with histone deacetylases and SUV39H1 to repress transcription.
16652140 2006 siRNA-mediated AML1/MTG8 depletion affects differentiation and proliferation-associated gene expression in t(8;21)-positive cell lines and primary AML blasts.
16628190 2006 Physical association of the patient-specific GATA1 mutants with RUNX1 in acute megakaryoblastic leukemia accompanying Down syndrome.
16627249 2006 Mutations of AML1 in non-M0 acute myeloid leukemia: six novel mutations and a high incidence of cooperative events in a South-east Asian population.
16616331 2006 The tetramer structure of the Nervy homology two domain, NHR2, is critical for AML1/ETO's activity.
16598304 2006 Identification of truncated RUNX1 and RUNX1-PRDM16 fusion transcripts in a case of t(1;21)(p36;q22)-positive therapy-related AML.
16519819 2006 Analysis of polymorphisms in 16 genes in type 1 diabetes that have been associated with other immune-mediated diseases.
16474840 2006 Decreased intranuclear mobility of acute myeloid leukemia 1-containing fusion proteins is accompanied by reduced mobility and compartmentalization of core binding factor beta.
16442267 2006 Runx1 transcription factor is involved in the regulation of KAP5 gene expression in human hair follicles.
16386788 2006 The incidence of T-cell receptor gene rearrangements in childhood B-lineage acute lymphoblastic leukemia is related to immunophenotype and fusion oncogene expression.
16314494 2005 Runx1 binds positive transcription elongation factor b and represses transcriptional elongation by RNA polymerase II: possible mechanism of CD4 silencing.
16307024 2006 Expression of Tel-Aml1 transcript variants in pediatric acute lymphoblastic leukemia.
16287839 2005 The hematopoietic transcription factor AML1 (RUNX1) is negatively regulated by the cell cycle protein cyclin D3.
16278392 2005 Immunogenotype changes prevail in relapses of young children with TEL-AML1-positive acute lymphoblastic leukemia and derive mainly from clonal selection.
16249223 2006 Study of the role of functional variants of SLC22A4, RUNX1 and SUMO4 in systemic lupus erythematosus.
16237704 2006 RUNX1 (AML-1) and RUNX2 (AML-3) cooperate with prostate-derived Ets factor to activate transcription from the PSA upstream regulatory region.
16213368 2005 The presence of TEL/AML1 rearrangement and cryptic deletion of the TEL gene in adult acute lymphoblastic leukemia (ALL).
16177090 2005 Reduction of Runx1 transcription factor activity up-regulates Fas and Bim expression and enhances the apoptotic sensitivity of double positive thymocytes.
16149049 2005 Subnuclear targeting of Runx1 is required for synergistic activation of the myeloid specific M-CSF receptor promoter by PU.1.
16102112 2005 A RUNX/AML-binding motif residing in a novel 13-bp DNA palindrome may determine the expression of the proximal promoter of the human uPA gene.
16042694 2005 AML1B transcriptional repressor function is impaired by the Flt3-internal tandem duplication.
15991223 2004 Increased expression of AML1-a and acquired chromosomal abnormalities in childhood acute lymphoblastic leukemia.
15970674 2005 TELAML1-positive ALL: a discordant genotype.
15968309 2005 [Role of molecular screening for common fusion genes in the diagnosis and classification of leukemia].
15914564 2005 Dysplastic definitive hematopoiesis in AML1/EVI1 knock-in embryos.
15856017 2005 Increased dosage of Runx1/AML1 acts as a positive modulator of myeloid leukemogenesis in BXH2 mice.
15829516 2005 The t(8;21) translocation converts AML1 into a constitutive transcriptional repressor.
15741216 2005 Low Mpl receptor expression in a pedigree with familial platelet disorder with predisposition to acute myelogenous leukemia and a novel AML1 mutation.
15735013 2005 Interplay of RUNX1/MTG8 and DNA methyltransferase 1 in acute myeloid leukemia.
15728845 2005 Role for Runx1 in the proliferation and neuronal differentiation of selected progenitor cells in the mammalian nervous system.
15723339 2005 MYND-less splice variants of AML1-MTG8 (RUNX1-CBFA2T1) are expressed in leukemia with t(8;21).
15705784 2005 AML1-FOG2 fusion protein in myelodysplasia.
15704129 2005 ETV6/RUNX1 fusion at diagnosis and relapse: some prognostic indications.
15688019 2005 Transcriptional cross-regulation of RUNX1 by RUNX3 in human B cells.
15654961 2005 Lack of evidence for genetic association to RUNX1 binding site at PSORS2 in different German psoriasis cohorts.
15618958 2005 Amplification or duplication of chromosome band 21q22 with multiple copies of the AML1 gene and mutation of the TP53 gene in therapy-related MDS and AML.
15613106 2005 Somatic point mutations in RUNX1/CBFA2/AML1 are common in high-risk myelodysplastic syndrome, but not in myelofibrosis with myeloid metaplasia.
15489901 2004 Williams-Beuren syndrome critical region-5/non-T-cell activation linker: a novel target gene of AML1/ETO.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475366 2004 Phorbol ester treatment of K562 cells regulates the transcriptional activity of AML1c through phosphorylation.
15386419 2005 Frequent downregulation of the runt domain transcription factors RUNX1, RUNX3 and their cofactor CBFB in gastric cancer.
15339695 2004 Two clonal occurrences of tetrasomy 21 in an atypical chronic myeloid leukemia with wild-type RUNX1 alleles. Additional support for a gene dosage effect of chromosome 21 or RUNX1 in leukemia.
15333839 2004 E protein silencing by the leukemogenic AML1-ETO fusion protein.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15203865 2004 Dose dependent long-term in vivo remission of AML1/ETO positive acute myeloid leukemia with G-CSF.
15184985 2004 SLC22A4 and RUNX1: identification of RA susceptible genes.
15179033 2004 Mechanism of transcriptional repression by TEL/RUNX1 fusion protein.
15142881 2004 Acute lymphoblastic leukemia with TEL-AML1 fusion has lower expression of genes involved in purine metabolism and lower de novo purine synthesis.
15142876 2004 Mutations of AML1 are common in therapy-related myelodysplasia following therapy with alkylating agents and are significantly associated with deletion or loss of chromosome arm 7q and with subsequent leukemic transformation.
15104290 2004 Cloning and sequencing of ETV6/RUNX1 (TEL/AML1) variant in acute lymphoblastic leukemia.
15104277 2004 Chromosome 21 tandem repetition and AML1 (RUNX1) gene amplification.
15061191 2004 Familial mutations of the transcription factor RUNX1 (AML1, CBFA2) predispose to acute myeloid leukemia.
15051730 2004 Regulation of tissue inhibitor of metalloproteinase 1 gene transcription by RUNX1 and RUNX2.
14970218 2004 Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
14966519 2004 AML-1 is required for megakaryocytic maturation and lymphocytic differentiation, but not for maintenance of hematopoietic stem cells in adult hematopoiesis.
14752096 2004 AML1 is functionally regulated through p300-mediated acetylation on specific lysine residues.
14747476 2004 AML1/RUNX1 increases during G1 to S cell cycle progression independent of cytokine-dependent phosphorylation and induces cyclin D3 gene expression.
14703694 2003 Interactions between the leukaemia-associated ETO homologues of nuclear repressor proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623259 2003 AML-1, PU.1, and Sp3 regulate expression of human bactericidal/permeability-increasing protein.
14615365 2004 High incidence of somatic mutations in the AML1/RUNX1 gene in myelodysplastic syndrome and low blast percentage myeloid leukemia with myelodysplasia.
14562119 2003 Dual mutations in the AML1 and FLT3 genes are associated with leukemogenesis in acute myeloblastic leukemia of the M0 subtype.
14561740 2004 A chromatin immunoprecipitation screen reveals protein kinase Cbeta as a direct RUNX1 target gene.
14525764 2004 Association of CBFA2 mutation with decreased platelet PKC-theta and impaired receptor-mediated activation of GPIIb-IIIa and pleckstrin phosphorylation: proteins regulated by CBFA2 play a role in GPIIb-IIIa activation.
14523475 2003 Amplification of AML1 in acute lymphoblastic leukemia is associated with a poor outcome.
12937148 2003 NCAM(CD56) and RUNX1(AML1) are up-regulated in human ischemic cardiomyopathy and a rat model of chronic cardiac ischemia.
12917624 2003 SUV39H1 interacts with AML1 and abrogates AML1 transactivity. AML1 is methylated in vivo.
12874780 2003 AML1/RUNX1 mutations are infrequent, but related to AML-M0, acquired trisomy 21, and leukemic transformation in pediatric hematologic malignancies.
12773394 2003 Epigenetic consequences of AML1-ETO action at the human c-FMS locus.
12760263 2003 Prognostic value of AML 1/ETO fusion transcripts in patients with acute myelogenous leukemia.
12699896 2003 Double trisomy 8 and 21 in acute myelocytic leukemias, one with rearrangement of the RUNX1 gene.
12643014 2003 AML1 interconnected pathways of leukemogenesis.
12604126 2003 The role of a Runt domain transcription factor AML1/RUNX1 in leukemogenesis and its clinical implications.
12576332 2003 RUNX1 and GATA-1 coexpression and cooperation in megakaryocytic differentiation.
12560229 2003 AML-1A and AML-1B regulation of MIP-1alpha expression in multiple myeloma.
12557226 2003 Cryptic chromosomal aberrations leading to an AML1/ETO rearrangement are frequently caused by small insertions.
12555067 2003 Identification of RUNX1/AML1 as a classical tumor suppressor gene.
12554803 2003 Characterization of promoter elements directing Mona/Gads molecular adapter expression in T and myelomonocytic cells: involvement of the AML-1 transcription factor.
12526921 2003 TEL-AML1 fusion precedes differentiation to pre-B cells in childhood acute lymphoblastic leukemia.
12496475 c-Myc overcomes cell cycle inhibition by CBFbeta-SMMHC, a myeloid leukemia oncoprotein.
12495904 2002 Core binding factor genes and human leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393679 2003 Implications of somatic mutations in the AML1 gene in radiation-associated and therapy-related myelodysplastic syndrome/acute myeloid leukemia.
12393523 2003 The AML1-ETO fusion gene promotes extensive self-renewal of human primary erythroid cells.
12393286 2002 AML1 amplification in a case of childhood acute lymphoblastic leukemia.
12377125 2002 DNA recognition by the RUNX1 transcription factor is mediated by an allosteric transition in the RUNT domain and by DNA bending.
12356919 2002 Transcription factors RUNX1/AML1 and RUNX2/Cbfa1 dynamically associate with stationary subnuclear domains.
12352981 2002 Runx3 controls the axonal projection of proprioceptive dorsal root ganglion neurons.
12217689 2002 The RUNX1 Runt domain at 1.25A resolution: a structural switch and specifically bound chloride ions modulate DNA binding.
12200707 2002 Mutation of the AML1/RUNX1 gene in a transient myeloproliferative disorder patient with Down syndrome.
12091359 2002 Immature CD34+CD19- progenitor/stem cells in TEL/AML1-positive acute lymphoblastic leukemia are genetically and functionally normal.
12060124 2002 A novel inherited mutation of the transcription factor RUNX1 causes thrombocytopenia and may predispose to acute myeloid leukaemia.
12002768 2002 Mutational analyses of the AML1 gene in patients with myelodysplastic syndrome.
11986950 2002 Potential involvement of the AML1-MTG8 fusion protein in the granulocytic maturation characteristic of the t(8;21) acute myelogenous leukemia revealed by microarray analysis.
11965546 2002 MOZ and MORF histone acetyltransferases interact with the Runt-domain transcription factor Runx2.
11742995 2001 Activation of AML1-mediated transcription by MOZ and inhibition by the MOZ-CBP fusion protein.
11641401 2002 Physical interaction of the activator protein-1 factors c-Fos and c-Jun with Cbfa1 for collagenase-3 promoter activation.
11276260 2001 The leukemia-associated AML1 (Runx1)--CBF beta complex functions as a DNA-induced molecular clamp.
11274169 2001 AP-1 and Cbfa/runt physically interact and regulate parathyroid hormone-dependent MMP13 expression in osteoblasts through a new osteoblast-specific element 2/AP-1 composite element.
11203699 2001 Expression and function of a stem cell promoter for the murine CBFalpha2 gene: distinct roles and regulation in natural killer and T cell development.
11118213 2000 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins.
10856244 2000 Structural basis for the heterodimeric interaction between the acute leukaemia-associated transcription factors AML1 and CBFbeta.
10830953 2000 The DNA sequence of human chromosome 21.
10825294 2000 Groucho/TLE/R-esp proteins associate with the nuclear matrix and repress RUNX (CBF(alpha)/AML/PEBP2(alpha)) dependent activation of tissue-specific gene transcription.
10713153 2000 Transcription-coupled translation control of AML1/RUNX1 is mediated by cap- and internal ribosome entry site-dependent mechanisms.
10675041 2000 Structure and expression pattern of a human MTG8/ETO family gene, MTGR1.
10545320 1999 The Ig fold of the core binding factor alpha Runt domain is a member of a family of structurally and functionally related Ig-fold DNA-binding domains.
10521447 1999 AML3/CBFalpha1 is required for androgen-specific activation of the enhancer of the mouse sex-limited protein (Slp) gene.
10508512 1999 Haploinsufficiency of CBFA2 causes familial thrombocytopenia with propensity to develop acute myelogenous leukaemia.
10455134 1999 AML1 (CBFalpha2) cooperates with B cell-specific activating protein (BSAP/PAX5) in activation of the B cell-specific BLK gene promoter.
10404214 1999 Immunoglobulin motif DNA recognition and heterodimerization of the PEBP2/CBF Runt domain.
10228168 1999 A WW domain-containing yes-associated protein (YAP) is a novel transcriptional co-activator.
10207087 1999 Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias.
10068652 1999 Biallelic and heterozygous point mutations in the runt domain of the AML1/PEBP2alphaB gene associated with myeloblastic leukemias.
9751710 1998 Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors.
9596646 1998 The partner gene of AML1 in t(16;21) myeloid malignancies is a novel member of the MTG8(ETO) family.
9199349 1997 A novel transcript encoding an N-terminally truncated AML1/PEBP2 alphaB protein interferes with transactivation and blocks granulocytic differentiation of 32Dcl3 myeloid cells.
9119228 1997 ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8700862 1996 Expression of the human acute myeloid leukemia gene AML1 is regulated by two promoter regions.
8634147 1996 A large variety of alternatively spliced and differentially expressed mRNAs are encoded by the human acute myeloid leukemia gene AML1.
8622955 1996 Disruption of the Cbfa2 gene causes necrosis and hemorrhaging in the central nervous system and blocks definitive hematopoiesis.
8622667 1996 CCAAT enhancer-binding protein (C/EBP) and AML1 (CBF alpha2) synergistically activate the macrophage colony-stimulating factor receptor promoter.
8565077 1996 AML1, the target of multiple chromosomal translocations in human leukemia, is essential for normal fetal liver hematopoiesis.
8490181 1993 Involvement of the AML1 gene in the t(3;21) in therapy-related leukemia and in chronic myeloid leukemia in blast crisis.
8413232 1993 Identification of AML-1 and the (8;21) translocation protein (AML-1/ETO) as sequence-specific DNA-binding proteins: the runt homology domain is required for DNA binding and protein-protein interactions.
8395054 1993 The 3;21 translocation in myelodysplasia results in a fusion transcript between the AML1 gene and the gene for EAP, a highly conserved protein associated with the Epstein-Barr virus small RNA EBER 1.
8353289 1993 Junctions of the AML1/MTG8(ETO) fusion are constant in t(8;21) acute myeloid leukemia detected by reverse transcription polymerase chain reaction.
8334990 1993 The t(8;21) translocation in acute myeloid leukemia results in production of an AML1-MTG8 fusion transcript.
8313895 1994 Generation of the AML1-EVI-1 fusion gene in the t(3;21)(q26;q22) causes blastic crisis in chronic myelocytic leukemia.
7919324 1994 Alternative, out-of-frame runt/MTG8 transcripts are encoded by the derivative (8) chromosome in the t(8;21) of acute myeloid leukemia M2.
7891692 1995 The t(8;21) fusion protein interferes with AML-1B-dependent transcriptional activation.
7862156 1995 Subcellular localization of the alpha and beta subunits of the acute myeloid leukemia-linked transcription factor PEBP2/CBF.
7835892 1994 AML1, AML2, and AML3, the human members of the runt domain gene-family: cDNA structure, expression, and chromosomal localization.
7795214 1995 AML1 and the 8;21 and 3;21 translocations in acute and chronic myeloid leukemia.
7780150 1995 The t(12;21) of acute lymphoblastic leukemia results in a tel-AML1 gene fusion.
7761424 1995 Fusion of the TEL gene on 12p13 to the AML1 gene on 21q22 in acute lymphoblastic leukemia.
7651838 1995 Alternative splicing and genomic structure of the AML1 gene involved in acute myeloid leukemia.
7541640 1995 Identification of two transcripts of AML1/ETO-fused gene in t(8;21) leukemic cells and expression of wild-type ETO gene in hematopoietic cells.
7533526 1994 AML1 fusion transcripts in t(3;21) positive leukemia: evidence of molecular heterogeneity and usage of splicing sites frequently involved in the generation of normal AML1 transcripts.
2845103 1988 Structure of the complex of adenylate kinase from Escherichia coli with the inhibitor P1,P5-di(adenosine-5'-)pentaphosphate.
1720541 1991 t(8;21) breakpoints on chromosome 21 in acute myeloid leukemia are clustered within a limited region of a single gene, AML1.
1560822 1992 Leukaemia/Drosophila homology.
1427868 1992 Linkage mapping of the AML1 gene on human chromosome 21 using a DNA polymorphism in the 3' untranslated region.
1423235 1992 Transcriptionally active chimeric gene derived from the fusion of the AML1 gene and a novel gene on chromosome 8 in t(8;21) leukemic cells.