Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.75
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -3.400 7.1e-07
astrocytic glioma -2.800 2.0e-03
Astrocytoma, Pilocytic -3.200 1.1e-11
atypical teratoid / rhabdoid tumor -5.000 4.8e-12
ependymoma -4.100 3.7e-03
glioblastoma -3.400 3.6e-10
lung carcinoma 4.200 2.3e-63
medulloblastoma -1.400 1.8e-03
medulloblastoma, large-cell -2.000 3.4e-07
oligodendroglioma -2.100 1.7e-02
osteosarcoma -1.047 4.8e-02
Pick disease -1.100 3.9e-02
primitive neuroectodermal tumor -2.200 2.6e-05
subependymal giant cell astrocytoma -1.865 3.7e-02

AA Sequence

MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILS      1 - 70
HRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSE     71 - 140
YITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS    141 - 210
YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLK    211 - 280
DLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL    281 - 350
NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGKDPTPSMLGLCGSLASIPSC    351 - 420
KSLASFKSNECLVSDSPEGSPALSPS                                                421 - 446
//

Text Mined References (13)

PMID Year Title