Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.48
PubTator Score 5.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 1.2e-04
pancreatic cancer 2300 1.6e-04
pancreatic carcinoma 567 1.6e-04
psoriasis 6685 2.7e-04
astrocytoma 1493 2.1e-03
glioblastoma 5572 3.5e-02
Disease Target Count Z-score Confidence
Eating disorder 24 0.0 1.0
Disease Target Count Z-score Confidence
Colorectal adenocarcinoma 6 3.259 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 1.6e-04
psoriasis 1.500 2.7e-04
astrocytoma 1.600 2.1e-03
glioblastoma 1.100 3.5e-02
pancreatic carcinoma 1.100 1.6e-04
ovarian cancer 1.400 1.2e-04

Gene RIF (3)

PMID Text
23144738 Data indicate that RUN and FYVE domain protein Rabip4'(RUFY1) interacts specifically and directly with adaptor protein complex AP-3.
20534812 These findings suggest that Rab14 and Rab4 act sequentially, together with RUFY1.
11877430 interaction with tyrosine kinase Etk

AA Sequence

MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAEGWSAPILTLA      1 - 70
RRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMMKLSIKVLLQSALSLGRSLDA     71 - 140
DHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSVRNLPELKTAVGRGRAW    141 - 210
LYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVI    211 - 280
DFSLYLKDVQDLDGGKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRI    281 - 350
CSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE    351 - 420
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQKNEAITSFEGK    421 - 490
TNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQA    491 - 560
LQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKEV    561 - 630
NQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLL    631 - 700
QRCSSTAS                                                                  701 - 708
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23144738 2012 AP-3 and Rabip4' coordinately regulate spatial distribution of lysosomes.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20534812 2010 Functional cross-talk between Rab14 and Rab4 through a dual effector, RUFY1/Rabip4.
19296456 2009 Membrane insertion of the FYVE domain is modulated by pH.
17233583 2007 Evolutionarily conserved structural and functional roles of the FYVE domain.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14617813 2004 Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11877430 2002 Interaction between tyrosine kinase Etk and a RUN domain- and FYVE domain-containing protein RUFY1. A possible role of ETK in regulation of vesicle trafficking.