Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.12
PubTator Score 4.23

Knowledge Summary


No data available


  Differential Expression (22)

Disease log2 FC p
chronic lymphocytic leukemia 1.215 4.2e-03
posterior fossa group B ependymoma -1.500 1.5e-04
oligodendroglioma -1.100 5.8e-03
cutaneous lupus erythematosus 2.100 9.4e-04
glioblastoma 2.300 4.0e-03
osteosarcoma -3.929 1.8e-04
group 3 medulloblastoma -2.800 1.8e-05
atypical teratoid / rhabdoid tumor -2.300 5.5e-07
medulloblastoma, large-cell -3.100 2.4e-08
tuberculosis -1.300 3.4e-03
non-small cell lung cancer -1.085 1.2e-08
intraductal papillary-mucinous carcinoma... -1.200 5.9e-04
colon cancer 2.300 1.5e-02
lung cancer 1.200 1.9e-04
interstitial cystitis 2.600 2.6e-03
pilocytic astrocytoma 1.200 3.2e-03
primary Sjogren syndrome 2.100 2.3e-04
subependymal giant cell astrocytoma 3.070 2.5e-03
Breast cancer -2.200 1.8e-11
ulcerative colitis 1.100 2.5e-04
ovarian cancer -3.100 1.7e-08
head and neck cancer and chronic obstruc... 1.500 8.9e-04


Accession Q9H714 A8KAG9 A8XR19 B3KS87 Q5W051 Q5W053 Q6PJ74 Q6PK94 Q86XH7 Q8N5J6
Symbols C13orf18


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Pathway (1)

Protein-protein Interaction (8)

Gene RIF (6)

25169519 MethyLight data demonstrated that C13orf18 and C1orf166 could not be considered as specific, sensitive and suitable prognostic biomarkers in cervical dysplasia related Papillomavirus Infections.
23522960 Re-activation of C13ORF18 led to partial demethylation of the C13ORF18 promoter and decreased repressive histone methylation.
21796628 Data suggest that the four-gene methylation panel might provide an alternative triage test after primary high-risk papillomavirus (hr-HPV) testing.
19843677 Methylation of C13orf18 in cervical scrapings is strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer.
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

FHKQCFQSSECPRCARITARRKLLESVASAAT                                          631 - 662

Text Mined References (14)

PMID Year Title
25169519 2014 C13orf18 and C1orf166 (MULAN) DNA genes methylation are not associated with cervical cancer and precancerous lesions of human papillomavirus genotypes in Iranian women.
23522960 2013 Functional validation of putative tumor suppressor gene C13ORF18 in cervical cancer by Artificial Transcription Factors.
21796628 2012 A four-gene methylation marker panel as triage test in high-risk human papillomavirus positive patients.
19843677 2009 Methylation markers for CCNA1 and C13ORF18 are strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer in cervical scrapings.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.