Property Summary

NCBI Gene PubMed Count 25
PubMed Score 78.62
PubTator Score 72.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.300 7.9e-08
ependymoma -1.200 1.9e-02
osteosarcoma -2.147 1.1e-07
astrocytoma 1.300 2.8e-03
medulloblastoma, large-cell -1.600 1.6e-06
juvenile dermatomyositis 1.998 6.7e-13
lung cancer -1.600 1.3e-02
ovarian cancer 2.100 7.4e-08

Gene RIF (11)

PMID Text
25807108 HCV, by differentially inducing the expression of Rubicon and UVRAG, temporally regulated the autophagic flux to enhance its replication.
23728897 This study demonistrated that KIAA0226 mutation impairs Rubicon endosomal localization
22527681 New DNA sequencing technologies are enabling us to investigate the whole or large targeted proportions of the genome in a rapid, affordable, and comprehensive way. Exome and targeted sequencing rundataxin genes causing ataxia.
22423967 Rubicon differentially targets signaling complexes, depending on environmental stimuli, and may function to coordinate various immune responses against microbial infection.
22423966 Rubicon may thus be pivotal to generating an optimal intracellular immune response against microbial infection.
21062745 a critical role of the Rubicon RUN domain in PI3KC3 and autophagy regulation
20974968 Rubicon serves as a previously unknown Rab7 effector to ensure the proper progression of the endocytic pathway.
20943950 Rubicon and PLEKHM1 specifically and directly interact with Rab7 via their RH domain; this interaction is critical for their function; show Rubicon but not PLEKHM1 uniquely regulates membrane trafficking via simultaneously binding both Rab7 and PI3-kinase
20826435 we report the identification of a family with three children affected with a new form of recessive ataxia, which we suggest naming 'Salih ataxia', and of a frameshift mutation of KIAA0226 (rundataxin) that segregates with the disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19270696 Two Beclin 1 associated proteins, Atg14L and Rubicon, were identified.

AA Sequence

MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLI      1 - 70
RDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLR     71 - 140
PLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTAL    141 - 210
PSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSV    211 - 280
SALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS    281 - 350
SNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP    351 - 420
ESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLE    421 - 490
KENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQEAEH    491 - 560
GSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVA    561 - 630
MGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQI    631 - 700
IFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSK    701 - 770
YYVSNFSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVP    771 - 840
GHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCR    841 - 910
TCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAEALALEAAVLEAT            911 - 972
//

Text Mined References (30)

PMID Year Title
25807108 2015 HCV induces the expression of Rubicon and UVRAG to temporally regulate the maturation of autophagosomes and viral replication.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23728897 2013 The Salih ataxia mutation impairs Rubicon endosomal localization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22527681 2012 Recent advances in the genetics of cerebellar ataxias.
22493499 2012 Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.
22423967 2012 The autophagy regulator Rubicon is a feedback inhibitor of CARD9-mediated host innate immunity.
22423966 2012 Autophagy protein Rubicon mediates phagocytic NADPH oxidase activation in response to microbial infection or TLR stimulation.
21118109 2010 The role of ESCRT proteins in fusion events involving lysosomes, endosomes and autophagosomes.
21062745 2011 The RUN domain of rubicon is important for hVps34 binding, lipid kinase inhibition, and autophagy suppression.
20974968 2010 Rubicon controls endosome maturation as a Rab7 effector.
20943950 2010 Rubicon and PLEKHM1 negatively regulate the endocytic/autophagic pathway via a novel Rab7-binding domain.
20826435 2010 Rundataxin, a novel protein with RUN and diacylglycerol binding domains, is mutant in a new recessive ataxia.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19550146 2009 Binding Rubicon to cross the Rubicon.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19270696 2009 Two Beclin 1-binding proteins, Atg14L and Rubicon, reciprocally regulate autophagy at different stages.
19270693 2009 Distinct regulation of autophagic activity by Atg14L and Rubicon associated with Beclin 1-phosphatidylinositol-3-kinase complex.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.