Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.18
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
West Syndrome 28 3.321 1.7
Cysticercosis 14 3.283 1.6

Expression

Gene RIF (3)

AA Sequence

MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPN      1 - 70
LKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARL     71 - 140
DESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEE    141 - 210
EATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV                     211 - 263
//

Text Mined References (9)

PMID Year Title