Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.43
PubTator Score 6.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.900 7.8e-06
astrocytic glioma -2.000 2.0e-03
Astrocytoma, Pilocytic -2.400 9.4e-09
atypical teratoid / rhabdoid tumor -1.800 2.3e-04
ependymoma -2.000 4.5e-03
glioblastoma -2.300 1.4e-09
group 4 medulloblastoma -2.400 8.9e-05
lung carcinoma 1.100 1.0e-21
medulloblastoma, large-cell -2.200 1.8e-04
oligodendroglioma -1.700 7.3e-03
osteosarcoma -1.123 1.7e-03
primitive neuroectodermal tumor -2.200 8.0e-04
psoriasis -1.400 9.3e-55

Gene RIF (3)

AA Sequence

MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQ      1 - 70
PGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSAL     71 - 140
PAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQ    141 - 210
WVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAV    211 - 280
PCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHR    281 - 350
KPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS    351 - 420
SASSLGASLLAWTLGLAVTLR                                                     421 - 441
//

Text Mined References (13)

PMID Year Title