Property Summary

NCBI Gene PubMed Count 11
PubMed Score 43.02
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-02
ependymoma -1.300 3.6e-02
oligodendroglioma -1.200 2.2e-02
osteosarcoma -1.820 1.6e-04
pancreatic ductal adenocarcinoma liver m... -1.498 2.0e-02
lung carcinoma 1.300 4.8e-28
acute myeloid leukemia -1.500 6.7e-03
ovarian cancer 1.200 9.0e-04

Gene RIF (4)

PMID Text
26593267 Recessive Mutations in RTN4IP1 Cause Isolated and Syndromic Optic Neuropathies.
23393170 RTN4IP1 has a tumor-suppressive function and may regulate thyroid cancer progression.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHY      1 - 70
PNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG     71 - 140
DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLI    141 - 210
LGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGS    211 - 280
TETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCL    281 - 350
DDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV                            351 - 396
//

Text Mined References (13)

PMID Year Title
26593267 2015 Recessive Mutations in RTN4IP1 Cause Isolated and Syndromic Optic Neuropathies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23393170 2013 RTN4IP1 is down-regulated in thyroid cancer and has tumor-suppressive function.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12160746 2002 Myelin-associated glycoprotein interacts with the Nogo66 receptor to inhibit neurite outgrowth.
12067236 2002 Identification and characterization of a novel Nogo-interacting mitochondrial protein (NIMP).