Property Summary

NCBI Gene PubMed Count 52
PubMed Score 36.51
PubTator Score 85.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 498 7.1e-04
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.586 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.200 7.1e-04

Gene RIF (29)

PMID Text
26164948 RTN 3 interacts with the N-terminal domain of EV71 2C, which is crucial for replication of viral RNA. [Review]
25319692 In Alzheimer's disease transgenic mouse models, RTN3 deficiency facilitates amyloid deposition.
24898729 Authors demonstrated that the second transmembrane region of RTN3 competed for, and bound to, the AH2 domain of hepatitis C virus NS4B, thus abolishing NS4B self-interaction and leading to the downregulation of viral replication.
23407961 successful prevention of imunoreactive dystrophic neurites formation should be initiated before RTN3 aggregation
22742855 This study demonistrated that Reduction of beta-amyloid accumulation by reticulon 3.
22190034 HIV-1 Vpu is identified to have a physical interaction with reticulon 3 (RTN3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21964562 we hypothesis that RTN3 may participate in the continuous process of circulating monocyte recruitment in atherosclerosis.
20717916 Reticulons, the only molecular so far to participate in all three apoptosis signaling pathways, may be a novel player in the progress of atherosclerosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374499 we examined reticulon-3 expression in cases of Alzheimer's disease, Parkinson's disease, and diffuse Lewy body disease
19730683 Observational study of gene-disease association. (HuGE Navigator)
19669607 common genetic variation in the BACE1-interacting proteins, RTN3 an PPIL2, does not influence platelet b-secretase activity or susceptibility to Alzheimer's disease in this population.
19669607 Observational study of gene-disease association. (HuGE Navigator)
19521671 CRELD1 could partly change the localization of RTN3 from the endoplasmic reticulum to the plasma membrane and modulate the apoptotic activity of RTN3 through binding with it.
19405102 RTN3 mutants w/o the N-terminal or C-terminal or loop domain bound BACE1 like wild-type & reduced Abeta40/42 secretion. Mutants of the the 1st or 2d potential transmembrane domains bound BACE1 but failed to inhibit Abeta secretion.
19386906 Elevated levels of RTN3 in transgenic RTN3 mice lead to an imbalance in the axonal transport of RTN3, which results in the accumulation of RTN3 in swollen neurites.
19364499 the disordered C-terminus of RTN3 is able to interact with FADD via a novel mode previously unobserved for FADD.
19284479 These results show that RTN3 is primarily expressed in pyramidal neurones of the human cerebral cortex and that no clear difference of RTN3 immunoreactivity is observable between control and Alzheimer's disease brains.
18854154 Knockdown of reticulon 3 (RTN3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17699523 the membrane topology of RTN3 has an effect on binding of RTN3 to BACE1
17379544 In normal HeLa cells, ectopic overexpressed Bcl-2 reduced the cell apoptosis induced by overexpressed RTN3. results suggest that RTN3 could bind with Bcl-2 and mediate its accumulation in mitochondria, which modulate the anti-apoptotic activity of Bcl-2.
17191123 These findings indicate that RTN3 is directly involved in the endoplasmic reticulum-constituents trafficking events through dually acting as an essential and important ER-stress sensor, and a trigger for the Bcl-2 translocation.
17031492 Endoplasmic reticulum, ER-bound RTN3 protein recruited endogenous FADD to the ER membrane and subsequently initiated caspase-8 cascade, including activation of caspase-8, processing of Bid and release of cytochrome c from mitochondria.
16979658 Results describe the mapping of interaction domains mediating binding between BACE1 and RTN3/Nogo proteins.
16847569 All the results indicate that both the mitochondria and the endoplasmic reticulum (ER) are involved in apoptosis caused by HAP overexpression, and suggest that HAP overexpression may initiate an ER overload response (EOR).
16054885 These results suggest that RTN3 plays a role in membrane trafficking in the early secretory pathway.
15560370 apoptosis-inducing protein, HAP, induces bacterial cell death [HAP, homolog of ASY protein]
15350194 RTN3 isoforms may contribute, by as yet unknown mechanisms, to neuronal survival and plasticity
12811824 The ASYIP protein co-localizes with ASY in the endoplasmic reticulum. Characterization of the ASYIP gene helps to clarify ASY-induced apoptosis or Nogo-involved inhibition of neuronal regeneration in the central nervous system.

AA Sequence

MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVSLFSTSQEGLS      1 - 70
SLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNV     71 - 140
SDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTA    141 - 210
QKPPTEYSKVEGIYTYSLSPSKVSGDDVIEKDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTD    211 - 280
KESSEDISETNDKLFPLRNKEAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQ    281 - 350
QTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKP    351 - 420
VPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDWQSSALGE    421 - 490
ITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIKEIPSCEREEKTSKNFEELVS    491 - 560
DSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAPEKPITTENPKLPSTVSPNVFNETEFSLNVT    561 - 630
TSAYLESLHGKNVKHIDDSSPEDLIAAFTETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGG    631 - 700
SEIKDIGSKYSEQSKETNGSEPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPS    701 - 770
EEVLKQTFTFAPESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLT    771 - 840
DFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGH    841 - 910
PFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLL    911 - 980
ILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE                      981 - 1032
//

Text Mined References (62)

PMID Year Title
26164948 2015 [Molecular Mechanism of Action of hnRNP K and RTN3 in the Replication of Enterovirus 71].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
25416956 2014 A proteome-scale map of the human interactome network.
25319692 2014 Impact of RTN3 deficiency on expression of BACE1 and amyloid deposition.
24898729 2014 Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.
24262037 2014 Arl6IP1 has the ability to shape the mammalian ER membrane in a reticulon-like fashion.
23407961 2013 Preventing formation of reticulon 3 immunoreactive dystrophic neurites improves cognitive function in mice.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22742855 2013 Reduction of ?-amyloid accumulation by reticulon 3 in transgenic mice.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21976701 2011 Protrudin serves as an adaptor molecule that connects KIF5 and its cargoes in vesicular transport during process formation.
21964562 2012 The potential role of RTN3 in monocyte recruitment and atherosclerosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20717916 2010 RTN3 and RTN4: Candidate modulators in vascular cell apoptosis and atherosclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374499 2010 Widespread distribution of reticulon-3 in various neurodegenerative diseases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19669607 2009 Variation in RTN3 and PPIL2 genes does not influence platelet membrane beta-secretase activity or susceptibility to alzheimer's disease in the northern Irish population.
19665976 2009 A class of dynamin-like GTPases involved in the generation of the tubular ER network.
19521671 2009 RTN3 inducing apoptosis is modulated by an adhesion protein CRELD1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19405102 2009 The two-hydrophobic domain tertiary structure of reticulon proteins is critical for modulation of beta-secretase BACE1.
19386906 2009 The occurrence of aging-dependent reticulon 3 immunoreactive dystrophic neurites decreases cognitive function.
19364499 2009 NMR studies reveal a novel mode for hFADD to bind with the unstructured hRTN3 which initiates the ER-stress activated apoptosis.
19284479 2009 Expression of reticulon 3 in Alzheimer's disease brain.
18779370 2008 Reshaping of the endoplasmic reticulum limits the rate for nuclear envelope formation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17699523 2007 The membrane topology of RTN3 and its effect on binding of RTN3 to BACE1.
17379544 2007 Anti-apoptotic activity of Bcl-2 is enhanced by its interaction with RTN3.
17191123 2007 Reticulon 3 mediates Bcl-2 accumulation in mitochondria in response to endoplasmic reticulum stress.
17182608 2007 Reticulon 3 binds the 2C protein of enterovirus 71 and is required for viral replication.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17031492 2006 Adaptor FADD is recruited by RTN3/HAP in ER-bound signaling complexes.
16979658 2006 Mapping of interaction domains mediating binding between BACE1 and RTN/Nogo proteins.
16965550 2006 Reticulons RTN3 and RTN4-B/C interact with BACE1 and inhibit its ability to produce amyloid beta-protein.
16847569 2006 Co-involvement of the mitochondria and endoplasmic reticulum in cell death induced by the novel ER-targeted protein HAP.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16054885 2005 Reticulon 3 is involved in membrane trafficking between the endoplasmic reticulum and Golgi.
15946766 2005 Identification of a new RTN3 transcript, RTN3-A1, and its distribution in adult mouse brain.
15799019 2005 ER Ca2+ depletion triggers apoptotic signals for endoplasmic reticulum (ER) overload response induced by overexpressed reticulon 3 (RTN3/HAP).
15560370 2004 Mammalian apoptosis-inducing protein, HAP, induces bacterial cell death.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15350194 2005 Tissue specificity and regulation of the N-terminal diversity of reticulon 3.
15286784 2004 Reticulon family members modulate BACE1 activity and amyloid-beta peptide generation.
15117958 2004 90-kDa ribosomal S6 kinase is a direct target for the nuclear fibroblast growth factor receptor 1 (FGFR1): role in FGFR1 signaling.
14986927 Overexpression of human reticulon 3 (hRTN3) in astrocytoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12873973 2003 Glucosylceramide synthase and its functional interaction with RTN-1C regulate chemotherapeutic-induced apoptosis in neuroepithelioma cells.
12832288 2003 A reticular rhapsody: phylogenic evolution and nomenclature of the RTN/Nogo gene family.
12811824 2003 Pro-apoptotic ASY/Nogo-B protein associates with ASYIP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054434 2002 Generation of multiple mRNA transcripts from the novel human apoptosis-inducing gene hap by alternative polyadenylation utilization and the translational activation function of 3' untranslated region.
10331947 1999 Cloning of a novel member of the reticulon gene family (RTN3): gene structure and chromosomal localization to 11q13.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.