Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.64
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-03
astrocytoma -1.200 7.2e-21
Astrocytoma, Pilocytic -1.500 1.8e-07
atypical teratoid/rhabdoid tumor -1.200 8.5e-05
ependymoma -1.200 1.4e-02
glioblastoma -1.500 2.2e-08
oligodendroglioma -1.200 6.7e-19

Gene RIF (5)

AA Sequence

MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEETTSQDWGTPRELTFSYIAFD      1 - 70
GVVGSGGRRDSTARRPRPQGRSVSEPRDQHPQPSLGDSLESIPSLSQSPEPGRRGDPDTAPPSERPLEDL     71 - 140
RLRLDHLGWVARGTGSGEDSSTSSSTPLEDEEPQEPNRLETGEAGEELDLRLRLAQPSSPEVLTPQLSPG    141 - 210
SGTPQAGTPSPSRSRDSNSGPEEPLLEEEEKQWGPLEREPVRGQCLDSTDQLEFTVEPRLLGTAMEWLKT    211 - 280
SLLLAVYKTVPILELSPPLWTAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLY    281 - 350
WKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVD    351 - 420
LTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLLILGVIGLFT    421 - 490
IPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAKAE                   491 - 545
//

Text Mined References (16)

PMID Year Title