Property Summary

NCBI Gene PubMed Count 40
PubMed Score 27.79
PubTator Score 28.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -5.300 5.1e-09
ependymoma -1.300 3.7e-02
psoriasis -2.000 1.7e-04
astrocytoma -1.400 2.4e-11
glioblastoma -3.200 1.3e-03
oligodendroglioma -1.300 1.4e-06
atypical teratoid / rhabdoid tumor -3.900 1.5e-05
medulloblastoma, large-cell -1.600 6.4e-04
Atopic dermatitis -1.100 2.9e-02
tuberculosis 3.900 6.4e-09
non-small cell lung cancer -1.756 2.5e-14
intraductal papillary-mucinous adenoma (... -2.600 2.8e-03
intraductal papillary-mucinous carcinoma... -3.000 1.8e-03
intraductal papillary-mucinous neoplasm ... -2.000 4.9e-02
lung cancer -1.500 3.8e-03
colon cancer -3.100 1.2e-03
sarcoidosis 1.100 4.7e-02
interstitial cystitis 1.800 8.7e-03
adult high grade glioma -2.800 2.1e-05
pilocytic astrocytoma -1.800 3.0e-06
primary Sjogren syndrome 1.700 1.3e-04
aldosterone-producing adenoma -1.415 1.7e-02
subependymal giant cell astrocytoma -4.746 4.3e-03
lung adenocarcinoma -1.374 1.0e-03
Pick disease -2.300 2.5e-03
Breast cancer -1.700 5.1e-03
invasive ductal carcinoma -1.500 7.7e-03
ovarian cancer -5.300 1.2e-15
facioscapulohumeral dystrophy -1.800 2.3e-02

Gene RIF (15)

PMID Text
26739891 RTN1A is a key mediator for proteinuria-induced tubular cell toxicity and renal fibrosis.
26496126 Results suggest evidence of genetic association between common variants in RTN1 and end-stage kidney disease in African-Americans and European-Americans.
26227493 RTN1A contributes to progression of kidney disease by inducing ER stress.
25573430 RTN-1C involvement in the regulation of Endoplasmic reticulum-mitochondria cross-talk, defines a role for RTN-1C in maintaining the function of contacts between the two organelles.
25543119 MANF is a protein that interacts with RTN1-C
23559015 RTN1-C induces PDI redistribution in endoplasmic reticulum vesicles, and concomitantly modulates its activity by decreasing the levels of its S-nitrosylated form.
22522967 In the present study a potential metal ion binding motif (HxE/D) at the C-terminal of the RTN1-C has been identified and its capability to bind metals investigated by UV-vis, CD, multidimensional NMR spectroscopy and biological assays.
20708685 RTN-1C is able to specifically regulate gene expression, modulating transcript clusters which have been implicated in the onset of neurodegenerative disorders
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19668229 RTN-1C protein binds to DNA and that its biological function is regulated by acetylation and is coupled to the inhibition of HDAC activity.
19140693 Nucleic acid binding of the RTN1-C C terminal region is reported with a view towards the functional role of a reticulon protein.
17596210 These data indicate that RTN-1C is able to modulate the cellular sensitivity to different apoptotic pathways representing a promising molecular target for new drug development.
17303085 analyzed the endoplasmic reticulum (ER) localization signal of human RTN1-A. Mutant proteins lacking the first (39 residues) or second (36 residues) hydrophobic segment showed ER localization
16602018 Data demonstrate that reticulon 1 interacts specifically with spastin.
14995077 RTN1-A and RTN1-B share N-terminal 168 amino acid region, suggesting that the 168 amino acid region might play a role in regulating the endocytic process

AA Sequence

MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAASREAGSGPARQ      1 - 70
SPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDSTYFTGILQKENGHVTISESP     71 - 140
EELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNKILADPLDQMKAEAYKYIDITRPEEVKHQEQ    141 - 210
HHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTP    211 - 280
VKITLTEIEPSVETTTQEKTPEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGS    281 - 350
ISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP    351 - 420
MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPKREQDSPPM    421 - 490
KPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGDGALEPETPMLPRKPEEDSSS    491 - 560
NQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALA    561 - 630
ALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLV    631 - 700
DSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPG    701 - 770
AKRHAE                                                                    771 - 776
//

Text Mined References (43)

PMID Year Title
26739891 2016 Knockdown of RTN1A attenuates ER stress and kidney injury in albumin overload-induced nephropathy.
26496126 2015 Association Analysis of the Reticulon 1 Gene in End-Stage Kidney Disease.
26227493 2015 RTN1 mediates progression of kidney disease by inducing ER stress.
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
25573430 2015 Reticulon protein-1C is a key component of MAMs.
25543119 2015 Identification of MANF as a protein interacting with RTN1-C.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23559015 2013 Reticulon1-C modulates protein disulphide isomerase function.
22522967 2012 A metal-binding site in the RTN1-C protein: new perspectives on the physiological role of a neuronal protein.
20708685 2010 Characterization of gene expression induced by RTN-1C in human neuroblastoma cells and in mouse brain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20000484 2010 Reticulon RTN1-C(CT) peptide: a potential nuclease and inhibitor of histone deacetylase enzymes.
19668229 2009 Acetylation of RTN-1C regulates the induction of ER stress by the inhibition of HDAC activity in neuroectodermal tumors.
19140693 2009 Nucleic acid binding of the RTN1-C C-terminal region: toward the functional role of a reticulon protein.
18088087 2008 Phosphoproteome of resting human platelets.
17786215 2007 The N-Myc down regulated Gene1 (NDRG1) Is a Rab4a effector involved in vesicular recycling of E-cadherin.
17684057 2007 Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.
17596210 2007 Reticulon-1C acts as a molecular switch between endoplasmic reticulum stress and genotoxic cell death pathway in human neuroblastoma cells.
17303085 2007 Two hydrophobic segments of the RTN1 family determine the ER localization and retention.
16602018 2006 Spastin, the most commonly mutated protein in hereditary spastic paraplegia interacts with Reticulon 1 an endoplasmic reticulum protein.
16505974 2006 Reticulon proteins: emerging players in neurodegenerative diseases.
16500619 2006 Cloning, expression, and preliminary structural characterization of RTN-1C.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15922294 2005 NDRG1 interacts with APO A-I and A-II and is a functional candidate for the HDL-C QTL on 8q24.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286784 2004 Reticulon family members modulate BACE1 activity and amyloid-beta peptide generation.
15086514 2004 Reticulon 1-C/neuroendocrine-specific protein-C interacts with SNARE proteins.
14995077 2003 Human reticulon 1-A and 1-B interact with a medium chain of the AP-2 adaptor complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12873973 2003 Glucosylceramide synthase and its functional interaction with RTN-1C regulate chemotherapeutic-induced apoptosis in neuroepithelioma cells.
12832288 2003 A reticular rhapsody: phylogenic evolution and nomenclature of the RTN/Nogo gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11126360 2000 A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on endoplasmic reticulum and reduces their anti-apoptotic activity.
9560466 1998 Neuronal differentiation is accompanied by NSP-C expression.
8900485 1996 Neuroendocrine-specific protein C (NSP-C): subcellular localization and differential expression in relation to NSP-A.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8833145 1996 Genomic organization of the human NSP gene, prototype of a novel gene family encoding reticulons.
8275708 1994 Regional mapping of the human NSP gene to chromosome region 14q21-->q22 by fluorescence in situ hybridization analysis.
8062278 1994 NSP-encoded reticulons are neuroendocrine markers of a novel category in human lung cancer diagnosis.
7844160 1994 NSP-encoded reticulons, neuroendocrine proteins of a novel gene family associated with membranes of the endoplasmic reticulum.
7685762 1993 Cloning and expression of alternative transcripts of a novel neuroendocrine-specific gene and identification of its 135-kDa translational product.
7515034 1994 Cluster-10 lung-cancer antibodies recognize NSPs, novel neuro-endocrine proteins associated with membranes of the endoplasmic reticulum.