Property Summary

NCBI Gene PubMed Count 10
PubMed Score 85.11
PubTator Score 37.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.479 2.5e-03
glioblastoma 1.200 4.0e-03
tuberculosis and treatment for 6 months 1.100 1.9e-03
lung cancer 1.100 8.1e-04
Alzheimer's disease -1.100 2.4e-02
Pick disease -1.400 3.8e-04
ovarian cancer 2.600 1.8e-05
dermatomyositis 1.400 2.1e-03

Gene RIF (1)

PMID Text
19690099 Rtc1 forms a stable binary complex with a 3'-phosphate terminated RNA, but not with an identical 3'-OH terminated RNA

AA Sequence

MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGA      1 - 70
EIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVF     71 - 140
KPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDM    141 - 210
AAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEM    211 - 280
LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKD    281 - 350
TYIIECQGIGMTNPNL                                                          351 - 366
//

Text Mined References (12)

PMID Year Title
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19690099 2009 Structure-activity relationships in human RNA 3'-phosphate cyclase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9184239 1997 The human RNA 3'-terminal phosphate cyclase is a member of a new family of proteins conserved in Eucarya, Bacteria and Archaea.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2199762 1990 RNA 3'-terminal phosphate cyclase from HeLa cells.