1. Home
  2. Targets
  3. Retbindin

Tdark Retbindin

Riboflavin-binding protein which might have a role in retinal flavin transport.

This gene was first identified in a study of human eye tissues. The protein encoded by this gene is preferentially expressed in the retina and may play a role in binding retinoids and other carotenoids as it shares homology with riboflavin binding proteins. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.67
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
ependymoma 2514
Disease Target Count P-value
ovarian cancer 8491 1.1e-08
osteosarcoma 7933 5.0e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.225 5.0e-06
ovarian cancer 1.400 1.1e-08

Synonym

Accession Q9BSG5 F1T0I8 Q9BWT5
Symbols

Gene

RTBDN

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (10)

 GO Component (2)

 Compartment GO Term (8)

 IMPC Phenotype (3)

 MGI Phenotype (3)

 HCA RNA Cell Line (54)

See all...

Pathway (1)

Protein-protein Interaction (7)

TSEN2   TTC19   UBAC1   ZER1   GAS6   COL6A1   AMD1  

Gene RIF (1)

PMID Text
25542898 retbindin is an excellent candidate for binding retinal flavins and possibly participating in their transport from the extracellular space to the photoreceptors.

AA Sequence 

MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETS      1 - 70
GPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLS     71 - 140
EKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPR    141 - 210
TSILDAAGSGSGSGSGSGP                                                       211 - 229
//

Text Mined References (12)

PMID Year Title
25542898 2015 Retbindin is an extracellular riboflavin-binding protein found at the photoreceptor/retinal pigment epithelium interface.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.