Property Summary

NCBI Gene PubMed Count 26
PubMed Score 29.31
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.500 7.1e-03
oligodendroglioma -2.000 4.1e-02
glioblastoma -2.700 6.4e-04
group 3 medulloblastoma -2.200 1.5e-02
medulloblastoma, large-cell -3.400 6.2e-04
primitive neuroectodermal tumor -3.300 4.7e-05
adult high grade glioma -2.300 1.6e-03
pilocytic astrocytoma -2.200 7.7e-05
posterior fossa group B ependymoma 1.600 1.7e-03
lung adenocarcinoma -1.200 2.8e-14
Pick disease -1.400 1.2e-02

Protein-protein Interaction (5)

Gene RIF (8)

PMID Text
25769727 Wnt(high) cells were more likely to give rise to Wnt(high) progeny, tended to be more metastatic, and revealed higher levels of RSPO2 expression.
24852883 These findings suggest that R-Spondin2 may promote hepatic stellate cell activation by enhancing the canonical Wnt pathway.
24847761 results suggest that the expression of RSPO fusion transcripts is related to a subset of colorectal cancers arising in the Japanese population
24476626 data reveal a RSPO2-induced, LGR5-dependent Wnt signaling-negative feedback loop that exerts a net growth-suppressive effect on CRC cells
23407710 Oocyte-derived R-spondin2 is a paracrine factor essential for primary ovarian follicle development
22895193 using RNA-seq data, identification of multiple fusion transcripts including recurrent gene fusions involving R-spondin family members RSPO2 and RSPO3 that together occur in 10% of colon tumours
22127703 Reduced Rspo-2 levels in osteoarthritis osteoblasts are responsible, at least in part, for their reduced Wnt/beta-catenin signaling and abnormal mineralization.
21160497 There is a role for R-spondin2 in keratinocyte proliferation and epidermal thickening in keloid scarring.

AA Sequence

MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQ      1 - 70
YGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETME     71 - 140
CVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTP    141 - 210
KAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ                                         211 - 243
//

Text Mined References (30)

PMID Year Title
26635199 2016 Further evidence of the involvement of the Wnt signaling pathway in Dupuytren's disease.
26416247 2015 LGR5 is associated with tumor aggressiveness in papillary thyroid cancer.
26269563 2015 DNA Methylation Predicts Progression of Human Gastric Lesions.
26052033 2015 Roles of miR-196a on gene regulation of neuroendocrine tumor cells.
25769727 2015 RSPO2 Enhances Canonical Wnt Signaling to Confer Stemness-Associated Traits to Susceptible Pancreatic Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24852883 2014 R-spondin2 activates hepatic stellate cells and promotes liver fibrosis.
24847761 2014 RSPO fusion transcripts in colorectal cancer in Japanese population.
24532711 2014 The R-spondin/Lgr5/Rnf43 module: regulator of Wnt signal strength.
24476626 2014 RSPO2-LGR5 signaling has tumour-suppressive activity in colorectal cancer.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23407710 2013 Oocyte-derived R-spondin2 promotes ovarian follicle development.
22895193 2012 Recurrent R-spondin fusions in colon cancer.
22615920 2012 LGR6 is a high affinity receptor of R-spondins and potentially functions as a tumor suppressor.
22127703 2011 R-spondins are newly recognized players in osteoarthritis that regulate Wnt signaling in osteoblasts.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21909076 2011 LGR4 and LGR5 are R-spondin receptors mediating Wnt/?-catenin and Wnt/PCP signalling.
21732829 2011 Wnt signaling and Dupuytren's disease.
21727895 2011 Lgr5 homologues associate with Wnt receptors and mediate R-spondin signalling.
21160497 2011 The role of R-spondin2 in keratinocyte proliferation and epidermal thickening in keloid scarring.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16357527 2006 R-Spondin proteins: a novel link to beta-catenin activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469841 2004 R-Spondin2 is a secreted activator of Wnt/beta-catenin signaling and is required for Xenopus myogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.