Property Summary

NCBI Gene PubMed Count 52
PubMed Score 188.66
PubTator Score 100.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma -1.400 5.3e-03
inflammatory breast cancer -1.900 2.9e-03
lung adenocarcinoma -2.500 4.3e-23
osteosarcoma -2.595 1.0e-08
ovarian cancer -3.200 1.8e-06

Protein-protein Interaction (7)

Gene RIF (26)

AA Sequence

MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIR      1 - 70
QVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTM     71 - 140
ECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQ    141 - 210
KRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA                     211 - 263
//

Text Mined References (52)

PMID Year Title