Property Summary

NCBI Gene PubMed Count 8
PubMed Score 19.10
PubTator Score 11.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.400 1.7e-03
osteosarcoma 2.358 2.3e-06
medulloblastoma, large-cell -2.200 7.3e-05
interstitial cystitis -1.400 5.3e-04
nasopharyngeal carcinoma -1.600 1.0e-06
ovarian cancer -1.600 9.5e-08

Synonym

Accession Q86UC2 Q96LQ5 Q96LX2 Q9BX75
Symbols RSP3
RSHL2
CILD32
dJ111C20.1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26073779 RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes.
19684019 Radial spoke protein 3 is a mammalian protein kinase A-anchoring protein that binds ERK1/2.

AA Sequence

MTVKPAKAASLARNLAKRRRTYLGGAAGRSQEPEVPCAAVLPGKPGDRNCPEFPPPDRTLGCWATDAAPA      1 - 70
AGLCGAGSEPSIAPTSCAGNLPSRPPPLLSPLLASRNPCPWHYLHLSGSHNTLAPTCFKAKLHRKRGSQP     71 - 140
PDMASALTDRTSRAPSTYTYTSRPRALPCQRSRYRDSLTQPDEEPMHYGNIMYDRRVIRGNTYALQTGPL    141 - 210
LGRPDSLELQRQREARKRALARKQAQEQLRPQTPEPVEGRKHVDVQTELYLEEIADRIIEVDMECQTDAF    211 - 280
LDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYE    281 - 350
ELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSG    351 - 420
YFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEPGGP    421 - 490
GAMTESLEASEFLEQSMSQTRELLLDGGYLQRTTYDRRSSQERKFMEERELLGQDEETAMRKSLGEEELS    491 - 560
//

Text Mined References (9)

PMID Year Title
26073779 2015 RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes.
25416956 2014 A proteome-scale map of the human interactome network.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
19684019 2009 Radial spoke protein 3 is a mammalian protein kinase A-anchoring protein that binds ERK1/2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225872 2004 Genomic organisation and nervous system expression of radial spoke protein 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.