Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.80
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.103 3.5e-05
astrocytoma -1.400 8.5e-04
Breast cancer 2.800 4.8e-02
hereditary spastic paraplegia -1.572 1.5e-03
lung cancer 1.100 8.5e-04
Multiple myeloma 2.075 1.5e-03
ovarian cancer -1.700 2.1e-04

Synonym

Accession Q9UHA3 B2RD72 Q561V8 Q8N6S8 Q96B04 Q96C76 Q96HJ1
Symbols L30
RLP24
RPL24
TVAS3
RPL24L
C15orf15
HRP-L30-iso

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFE      1 - 70
FEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAG     71 - 140
KGKQLEEKMVQQLQEDVDMEDAP                                                   141 - 163
//

Text Mined References (14)

PMID Year Title