Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.61
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
17686765 RSC1A1 codes for a 67-kDa protein named RS1 that mediates transcriptional and post-transcriptional regulation of Na(+)-D-glucose cotransporter SGLT1.
16788147 RS1 inhibits the dynamin-dependent release of SGLT1-containing vesicles from the trans-golgi network
16788146 hRS1 protein exhibits glucose-dependent, short-term inhibition of hSGLT1 and hOCT2 by inhibiting the release of vesicles from the trans-Golgi network
14724758 Taken together, these data indicate that RSC1A1 modulates dynamin-dependent trafficking of intracellular vesicles containing hSGLT1 in Xenopus oocytes, and modulates PKC-dependent short-term regulation of this transporter.

AA Sequence

MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKE      1 - 70
HLSLQDLSDHASSADHAPTDQSPAMPMQNSSEEITVAGNLEKSAERSTQGLKFHLHTRQEASLSVTSTRM     71 - 140
HEPQMFLGEKDWHPENQNLSQVSDPQQHEEPGNEQYEVAQQKASHDQEYLCNIGDLELPEERQQNQHKIV    141 - 210
DLEATMKGNGLPQNVDPPSAKKSIPSSECSGCSNSETFMEIDTAQQSLVTLLNSTGRQNANVKNIGALDL    211 - 280
TLDNPLMEVETSKCNPSSEILNDSISTQDLQPPETNVEIPGTNKEYGHYSSPSLCGSCQPSVESAEESCP    281 - 350
SITAALKELHELLVVSSKPASENTSEEVICQSETIAEGQTSIKDLSERWTQNEHLTQNEQCPQVSFHQAI    351 - 420
SVSVETEKLTGTSSDTGREAVENVNFRSLGDGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGV    421 - 490
EISPKLLAGEEDALNQTSEQTKSLSSNFILVKDLGQGIQNSVTDRPETRENVCPDASRPLLEYEPPTSHP    491 - 560
SSSPAILPPLIFPATDIDRILRAGFTLQEALGALHRVGGNADLALLVLLAKNIVVPT                 561 - 617
//

Text Mined References (14)

PMID Year Title
26464324 2016 Phosphorylation of RS1 (RSC1A1) Steers Inhibition of Different Exocytotic Pathways for Glucose Transporter SGLT1 and Nucleoside Transporter CNT1, and an RS1-Derived Peptide Inhibits Glucose Absorption.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19765263 2009 Novel shuttling domain in a regulator (RSC1A1) of transporter SGLT1 steers cell cycle-dependent nuclear location.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17686765 2007 Tripeptides of RS1 (RSC1A1) inhibit a monosaccharide-dependent exocytotic pathway of Na+-D-glucose cotransporter SGLT1 with high affinity.
16788147 2006 Transporter regulator RS1 (RSC1A1) coats the trans-Golgi network and migrates into the nucleus.
16788146 2006 RS1 (RSC1A1) regulates the exocytotic pathway of Na+-D-glucose cotransporter SGLT1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14724758 2003 Downregulation of the Na(+)- D-glucose cotransporter SGLT1 by protein RS1 (RSC1A1) is dependent on dynamin and protein kinase C.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11018680 2000 The transport modifier RS1 is localized at the inner side of the plasma membrane and changes membrane capacitance.
8836035 1996 The human gene of a protein that modifies Na(+)-D-glucose co-transport.
8751391 1996 Assignment of the membrane-associated modulator of the Na(+)-sugar cotransport systems gene RSC1A1 to human chromosome 1p36.1 by in situ hybridization.
2675563 1989 Physical maps of the mouse and human immunoglobulin-like loci.