Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.88
PubTator Score 5.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 133 0.0 0.0
Stomach Neoplasms 287 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3135 3.3e-05
medulloblastoma, large-cell 6086 9.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Diffuse Scleroderma 7 4.246 2.1
Localized scleroderma 8 3.994 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 3.3e-05
medulloblastoma, large-cell 1.600 9.0e-04

 GO Function (1)

 GO Process (1)

Gene RIF (3)

AA Sequence

MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEISSDSESESLAPRKPEEEEEEE      1 - 70
LEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQRGRLQKLVAKEIQAPASADIR     71 - 140
VLRGHQLSITCLVVTPDDSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSSHVLCMAISSD    141 - 210
GKYLASGDRSKLILIWEAQSCQHLYTFTGHRDAVSGLAFRRGTHQLYSTSHDRSVKVWNVAENSYVETLF    211 - 280
GHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALW    281 - 350
GLSKKRPLALQREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCVRLWQCGEGFRQLDLLCDIPL    351 - 420
VGFINSLKFSSSGDFLVAGVGQEHRLGRWWRIKEARNSVCIIPLRRVPVPPAAGS                   421 - 475
//

Text Mined References (23)

PMID Year Title