Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.83
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.1e-06
group 3 medulloblastoma 2254 2.6e-05
diabetes mellitus 1663 1.0e-03
Disease Target Count Z-score Confidence
Meningioma 27 3.263 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 2.6e-05
diabetes mellitus -1.500 1.0e-03
ovarian cancer 2.400 1.1e-06

 GO Function (1)

Gene RIF (1)

PMID Text
20038530 studied the orthologue of Rrp36p in HeLa cells, and showed that the function of this protein in early cleavages of the pre-rRNA has been conserved through evolution in eukaryotes

AA Sequence

MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVA      1 - 70
GNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQF     71 - 140
LNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPY    141 - 210
FLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE                         211 - 259
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20038530 2010 Evolutionarily conserved function of RRP36 in early cleavages of the pre-rRNA and production of the 40S ribosomal subunit.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15983380 2005 Complex humoral immune response against a benign tumor: frequent antibody response against specific antigens as diagnostic targets.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.