Property Summary

NCBI Gene PubMed Count 28
PubMed Score 10.07
PubTator Score 9.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.055 5.8e-03
astrocytoma 1.400 1.5e-03
medulloblastoma, large-cell 1.600 9.0e-06
juvenile dermatomyositis 1.477 2.2e-11
acute quadriplegic myopathy 1.370 2.3e-06
tuberculosis and treatment for 6 months 1.200 5.3e-04
intraductal papillary-mucinous carcinoma... -1.100 1.4e-02
colon cancer 1.200 3.0e-04
lung cancer 1.300 5.1e-04
ovarian cancer 1.200 1.6e-03

Synonym

Accession Q14684 Q8TBZ4
Symbols Nnp1
RRP1
NNP1L
KIAA0179
PPP1R136

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (12)

PMID Text
26311876 this study characterized the rRNA processing 1 homolog B (RRP1B) protein as an important cellular factor for influenza A virus transcription.
25277657 Presence of Rrp1b1307TT genotype and T allele confer strong risk for breast cancer development and progression.
25092915 Data show that RRP1B regulates metastasis associated gene expression by interacting with the transcriptional corepressors TRIM28 and HP1a, which act by recruiting chromatin-modifying enzymes.
24260471 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
22552340 Expression of RRP1B, PCNT, KIF21A and ADRB2 in leucocytes of Down's syndrome subjects, was analyzed.
20926688 identified and characterized a major nucleolar pool of PP1 targeted to pre-60S ribosomal subunit processing complexes by RRP1B
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20040599 E2F1 makes use of its transcriptional target RRP1B to activate other genes directly involved in apoptosis.
19825179 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19710015 RRP1B, a tumor progression and metastasis susceptibility candidate gene, is potentially a dynamic modulator of transcription and chromatin structure
18081427 Observational study of gene-disease association. (HuGE Navigator)
18081427 These data suggest that RRP1B may be a novel susceptibility gene for breast cancer progression and metastasis.

AA Sequence

MAPAMQPAEIQFAQRLASSEKGIRDRAVKKLRQYISVKTQRETGGFSQEELLKIWKGLFYCMWVQDEPLL      1 - 70
QEELANTIAQLVHAVNNSAAQHLFIQTFWQTMNREWKGIDRLRLDKYYMLIRLVLRQSFEVLKRNGWEES     71 - 140
RIKVFLDVLMKEVLCPESQSPNGVRFHFIDIYLDELSKVGGKELLADQNLKFIDPFCKIAAKTKDHTLVQ    141 - 210
TIARGVFEAIVDQSPFVPEETMEEQKTKVGDGDLSAEEIPENEVSLRRAVSKKKTALGKNHSRKDGLSDE    211 - 280
RGRDDCGTFEDTGPLLQFDYKAVADRLLEMTSRKNTPHFNRKRLSKLIKKFQDLSEGSSISQLSFAEDIS    281 - 350
ADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAA    351 - 420
PSLEQNRGREPEASGLKALKARVAEPGAEATSSTGEESGSEHPPAVPMHNKRKRPRKKSPRAHREMLESA    421 - 490
VLPPEDMSQSGPSGSHPQGPRGSPTGGAQLLKRKRKLGVVPVNGSGLSTPAWPPLQQEGPPTGPAEGANS    491 - 560
HTTLPQRRRLQKKKAGPGSLELCGLPSQKTASLKKRKKMRVMSNLVEHNGVLESEAGQPQALGSSGTCSS    561 - 630
LKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTD    631 - 700
KSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTTTPRRRPRAMDFF                701 - 758
//

Text Mined References (41)

PMID Year Title
26311876 2015 A Nucleolar Protein, Ribosomal RNA Processing 1 Homolog B (RRP1B), Enhances the Recruitment of Cellular mRNA in Influenza Virus Transcription.
25277657 2015 Rrp1B gene polymorphism (1307T>C) in metastatic progression of breast cancer.
25092915 2014 Metastasis-associated protein ribosomal RNA processing 1 homolog B (RRP1B) modulates metastasis through regulation of histone methylation.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260471 2013 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22552340 2012 Gene expression profiling and qRT-PCR expression of RRP1B, PCNT, KIF21A and ADRB2 in leucocytes of Down's syndrome subjects.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20926688 2010 RRP1B targets PP1 to mammalian cell nucleoli and is associated with Pre-60S ribosomal subunits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20040599 2010 Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B.
19825179 2009 Distinct inherited metastasis susceptibility exists for different breast cancer subtypes: a prognosis study.
19710015 2009 The metastasis efficiency modifier ribosomal RNA processing 1 homolog B (RRP1B) is a chromatin-associated factor.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18081427 2007 Rrp1b, a new candidate susceptibility gene for breast cancer progression and metastasis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11790298 2002 Directed proteomic analysis of the human nucleolus.
10830953 2000 The DNA sequence of human chromosome 21.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.