Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.28
PubTator Score 12.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (4)

AA Sequence

MVSRVQLPPEIQLAQRLAGNEQVTRDRAVRKLRKYIVARTQRAAGGFTHDELLKVWKGLFYCMWMQDKPL      1 - 70
LQEELGRTISQLVHAFQTTEAQHLFLQAFWQTMNREWTGIDRLRLDKFYMLMRMVLNESLKVLKMQGWEE     71 - 140
RQIEELLELLMTEILHPSSQAPNGVKSHFIEIFLEELTKVGAEELTADQNLKFIDPFCRIAARTKDSLVL    141 - 210
NNITRGIFETIVEQAPLAIEDLLNELDTQDEEVASDSDESSEGGERGDALSQKRSEKPPAGSICRAEPEA    211 - 280
GEEQAGDDRDSGGPVLQFDYEAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACR    281 - 350
RLLEGRRQKKTKKQKRLLRLQQERGKGEKEPPSPGMERKRSRRRGVGADPEARAEAGEQPGTAERALLRD    351 - 420
QPRGRGQRGARQRRRTPRPLTSARAKAANVQEPEKKKKRRE                                 421 - 461
//

Text Mined References (24)

PMID Year Title