Property Summary

NCBI Gene PubMed Count 19
PubMed Score 46.23
PubTator Score 27.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 4.2e-06
psoriasis 6685 3.5e-05
group 4 medulloblastoma 1875 3.4e-04

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.000 3.5e-05
group 4 medulloblastoma 1.400 3.4e-04
acute quadriplegic myopathy 1.182 4.2e-06

Protein-protein Interaction (9)

Gene RIF (8)

PMID Text
24297901 These data support a model in which activated Akt enhances rRNA synthesis both by preventing TIF-IA degradation and phosphorylating CK2alpha, which in turn phosphorylates TIF-IA.
23393135 DNA binding by the ribosomal DNA transcription factor rrn3 is essential for ribosomal DNA transcription
21940764 reveals the molecular basis of Rrn3-regulated Pol I initiation and cell growth
18559419 CK2 phosphorylates the transcription initiation factor TIF-IA at serines 170 and 172 (Ser170/172), and this phosphorylation triggers the release of TIF-IA from Pol I after transcription initiation.
18047649 The definition of the Alu element within the TIF-IA gene as an exon is restricted to certain types of cancers; the element is not exonized in normal human cells.
15004009 Phosphorylation of S44 activates and S199 inactivates TIF-IA.
12620228 ERK-dependent phosphorylation of the transcription initiation factor TIF-IA is required for RNA polymerase I transcription and cell growth.
12393749 Data show that nutrient starvation, density arrest and protein synthesis inhibitors inactivate transcription initiation factor-IA and impair its association with RNA polymerase I.

AA Sequence

MAAPLLHTRLPGDAAASSSAVKKLGASRTGISNMRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETND      1 - 70
FELLKNQLLDPDIKDDQIINWLLEFRSSIMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSAQ     71 - 140
TVFLRPCLSMIASHFVPPRVIIKEGDVDVSDSDDEDDNLPANFDTCHRALQIIARYVPSTPWFLMPILVE    141 - 210
KFPFVRKSERTLECYVHNLLRISVYFPTLRHEILELIIEKLLKLDVNASRQGIEDAEETATQTCGGTDST    211 - 280
EGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINI    281 - 350
FDKLLLPTHASCHVQFFMFYLCSFKLGFAEAFLEHLWKKLQDPSNPAIIRQAAGNYIGSFLARAKFIPLI    351 - 420
TVKSCLDLLVNWLHIYLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYLQSLN    421 - 490
FERIVMSQLNPLKICLPSVVNFFAAITNKYQLVFCYTIIERNNRQMLPVIRSTAGGDSVQICTNPLDTFF    491 - 560
PFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTH    561 - 630
FRSPSSSVGSPPVLYMQPSPL                                                     631 - 651
//

Text Mined References (27)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24297901 2013 Akt activation enhances ribosomal RNA synthesis through casein kinase II and TIF-IA.
23393135 2013 DNA binding by the ribosomal DNA transcription factor rrn3 is essential for ribosomal DNA transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
21940764 2011 Molecular basis of Rrn3-regulated RNA polymerase I initiation and cell growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559419 2008 Phosphorylation by casein kinase 2 facilitates rRNA gene transcription by promoting dissociation of TIF-IA from elongating RNA polymerase I.
18047649 2007 Biased exonization of transposed elements in duplicated genes: A lesson from the TIF-IA gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15805466 2005 The nucleolus as a stress sensor: JNK2 inactivates the transcription factor TIF-IA and down-regulates rRNA synthesis.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15004009 2004 mTOR-dependent activation of the transcription factor TIF-IA links rRNA synthesis to nutrient availability.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12620228 2003 ERK-dependent phosphorylation of the transcription initiation factor TIF-IA is required for RNA polymerase I transcription and cell growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
11265758 2000 TIF-IA, the factor mediating growth-dependent control of ribosomal RNA synthesis, is the mammalian homolog of yeast Rrn3p.
11250903 2001 hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters.
10758157 2000 RNA polymerase I transcription factor Rrn3 is functionally conserved between yeast and human.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.