Property Summary

NCBI Gene PubMed Count 54
PubMed Score 86.40
PubTator Score 97.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.1e-03
medulloblastoma -1.200 1.7e-03
medulloblastoma, large-cell -1.500 2.6e-02
acute quadriplegic myopathy 1.634 4.8e-06
tuberculosis -1.100 3.4e-05
subependymal giant cell astrocytoma 1.966 1.3e-02
ovarian cancer 1.700 2.5e-03

Protein-protein Interaction (4)

Gene RIF (46)

PMID Text
25878246 analysis of caspase-dependent degradation of human R2 and p53R2 small subunits
25312903 A newly discovered role of E2F1 in the regulation of p53R2 expression in DNA damage response.
24947616 Data indicate that forkhead transcription factorsF OXO3 directly bound to and transcriptionally activated the promoter of ribonucleotide reductase subunit RRM2B, and induced the expression of RRM2B at RNA and protein levels.
24861915 in Turkish population p53R2 genotype distributions between head and neck squamous epithelial cell cancer patients and control groups were not statistically significantly different.
24215511 we found no support of the hypothesis that aberrations of RRM1 or RRM2B, neither individually nor in combination, are associated with an altered clinical outcome following chemotherapy.
24214128 Ribonucleotide reductase M2B inhibits cell migration and spreading by early growth response protein 1-mediated phosphatase and tensin homolog/Akt1 pathway in hepatocellular carcinoma.
24162774 HIV-1 gp120 upregulates the expression of ribonucleotide reductase M2 B (RRM2B) in human B cells
23552804 RRM2B expression may discriminate cervical cancer phenotype and radiochemotherapy outcome
23139867 RRM2B is highly induced in a p53-dependent manner during senescence and is expressed at higher levels in senescent precancerous human prostatic intraepithelial neoplasm lesions compared to adjacent normal prostate glands.
22954457 p53R2 could regulate matrix synthesis via Akt phosphorylation during chondrocyte mechanotransduction. Down-regulation of p53R2 may be a new therapeutic approach in OA therapy.
22902076 Propose p53R2 as a therapeutic target to enhance the effectiveness of chemotherapy in patients with p53R2-positive melanoma.
22895183 p53R2 is directly regulated by p53 and also by a MEK2 (ERK kinase 2/MAP kinase kinase 2)-dependent pathway.
22884950 These results confirm a role for p53R2 in both Clofarabine and decitabine mechanism of action
22847445 In nontransformed cells only during quiescence, protein p53R2 is required for maintenance of mitochondrial DNA and for optimal DNA repair after ultraviolet damage.
21965764 p53R2 expression seems more important than that of hRRM2 in prognosis of early-stage lung cancer.
21646632 Adult-onset progressive external ophthalmoplegia due to RRM2B mutations is associated with a benign myopathic phenotype and characterized by muscle-restricted, mitochondrial DNA deletions.
21640705 this study provides functional evidence that mitochondria is one of p53R2-targeted organelles and suggests an unexpected function of p53R2, which is beyond known ribonucleotide reductase function on dNTP synthesis, in mitochondrial homeostatic control.
21451941 Increased expression of p53R2 may predict gemcitabine resistance, and upregulated RNR activity may influence gemcitabine resistance in cholangiocarcinoma cells.
21378381 Evidence that disease pathogenesis may be caused by defective RNR assembly is given.
21297166 oss of p53R2 affects ribonucleotide reduction only in resting cells and leads to a decrease of dNTP catabolism by substrate cycles that counterweigh the loss of anabolic activity
21216934 p53R2 may suppress cancer cell proliferation; plays critical roles not only in DNA damage repair but also in proliferation of cancer cells
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20484015 This study correlates the distinct catalytic mechanisms of the small subunits hp53R2 and hRRM2 with a hydrogen-bonding network.
19728742 The X-ray crystal structure of human p53R2 is determined to 2.6 A, in which monomers A and B exhibit mono- and binuclear iron occupancy, respectively. Sequence-structure-function correlations that differentiate p53R2 and RRM2 are revealed.
19667227 This study expands the clinical spectrum of impaired RIR2B function.
19664747 A heterozygous truncating mutation in RRM2B causes autosomal-dominant progressive external ophthalmoplegia with multiple mtDNA deletions.
19138848 This report describes two brothers, both deceased in infancy, with severe depletion of mitochondrial DNA (mtDNA) in muscle tissue. A novel missense mutation in the RRM2B gene, encoding the p53R2 subunit, was identified
19082948 The redox property, structure, and function of hRRM2 and p53R2, are studied.
18760875 p53R2 constitutes a potential target for anticancer drugs as well as a diagnostic marker in cancer.
18505925 analysis of the effects of p53R2 silencing on DNA damage in LNCaP cells
18504129 Sequencing the RRM2B gene revealed three missense mutations and two single nucleotide deletions in exons 6, 8, and 9, confirming that RRM2B mutations are important causes of MDS.
18474260 a protective function of the p53R2 ribonucleotide reductase subunit in prevention or repair of NO-mediated genotoxic injury.
17671702 p53R2 expression is reduced after X-ray irradiation following the transfection of p53R2 siRNAin esophageal squamous cell carcinoma. This could potentially improve efficacy of radiotheraepy.
17486094 Mutation of RRM2B is associated with mitochondrial Diseases
16872707 ectopic expression of human papillomavirus 16 E6 impaired p53R2 induction after DNA damage in human fibroblasts
16846634 Catalytic properties are assessed.
16778101 Expressions of p53 and p53R2 proteins should be useful for determining the tumor properties, including prognosis, in patients with esophageal squamous cell carcinoma.
16407418 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16376858 RRM2 and p53R2 subunits share the same binding site on RRM1
16236544 we developed a p53R2-dependent luciferase reporter gene assay, and demonstrated dose-dependent luminescence caused by adriamycin in two human cell lines that express wild-type p53, MCF-7 and HepG2
16127747 Observational study of gene-disease association. (HuGE Navigator)
16127747 Four regulatory-region variants were found, of which three were single nucleotide polymorphisms (SNPs) (nt 1 789 C/G, nt 1 928 A/G, 1 933 T/C), and one was 20 bp insertion which replaced a ATTTT between nt 1831 and 1835.
14583450 UV-induced activation of p53R2 transcription and binding of p53R2 to hRRM1 to form RR holoenzyme are impaired in the p53-mutant cell line PC3.
12615712 Wild-type p53 regulates human ribonucleotide reductase by protein-protein interaction with p53R2 as well as hRRM2 subunits.
12565178 Expression of p53R2, newly p53 target in oral normal epithelium, epithelial dysplasia and squamous cell carcinoma.
11719458 p53R2-dependent DNA synthesis plays a pivotal role in cell survival by repairing damaged DNA

AA Sequence

MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD      1 - 70
LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL     71 - 140
LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK    141 - 210
RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI    211 - 280
LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD    281 - 350
F//

Text Mined References (58)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
25878246 2015 Caspase-dependent Proteolysis of Human Ribonucleotide Reductase Small Subunits R2 and p53R2 during Apoptosis.
25416956 2014 A proteome-scale map of the human interactome network.
25312903 2015 E2F1 regulates p53R2 gene expression in p53-deficient cells.
24947616 2014 Tumor suppressor FOXO3 regulates ribonucleotide reductase subunit RRM2B and impacts on survival of cancer patients.
24861915 2014 Investigation of the association of hRRM1 and p53R2 gene polymorphisms in head and neck squamous cell carcinomas.
24215511 2013 Gene aberrations of RRM1 and RRM2B and outcome of advanced breast cancer after treatment with docetaxel with or without gemcitabine.
24214128 2014 Ribonucleotide reductase M2B inhibits cell migration and spreading by early growth response protein 1-mediated phosphatase and tensin homolog/Akt1 pathway in hepatocellular carcinoma.
23552804 2013 Ribonucleotide reductase expression in cervical cancer: a radiation therapy oncology group translational science analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23139867 2012 RRM2B suppresses activation of the oxidative stress pathway and is up-regulated by p53 during senescence.
22954457 2012 Akt phosphorylation in human chondrocytes is regulated by p53R2 in response to mechanical stress.
22902076 2012 p53R2 is a prognostic factor of melanoma and regulates proliferation and chemosensitivity of melanoma cells.
22895183 2012 MEK2 regulates ribonucleotide reductase activity through functional interaction with ribonucleotide reductase small subunit p53R2.
22884950 2012 Synergism between clofarabine and decitabine through p53R2: a pharmacodynamic drug-drug interaction modeling.
22847445 2012 Mammalian ribonucleotide reductase subunit p53R2 is required for mitochondrial DNA replication and DNA repair in quiescent cells.
21965764 2011 Expression status of ribonucleotide reductase small subunits hRRM2/p53R2 as prognostic biomarkers in stage I and II non-small cell lung cancer.
21646632 2011 RRM2B mutations are frequent in familial PEO with multiple mtDNA deletions.
21640705 2011 Ribonucleotide reductase subunit p53R2 regulates mitochondria homeostasis and function in KB and PC-3 cancer cells.
21451941 2011 Gene expression analysis for predicting gemcitabine resistance in human cholangiocarcinoma.
21378381 2011 Kearns-Sayre syndrome caused by defective R1/p53R2 assembly.
21297166 2011 Deoxyribonucleotide metabolism in cycling and resting human fibroblasts with a missense mutation in p53R2, a subunit of ribonucleotide reductase.
21269460 2011 Initial characterization of the human central proteome.
21216934 2011 p53R2 inhibits the proliferation of human cancer cells in association with cell-cycle arrest.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20484015 2010 Structural basis on the dityrosyl-diiron radical cluster and the functional differences of human ribonucleotide reductase small subunits hp53R2 and hRRM2.
19728742 2009 2.6 A X-ray crystal structure of human p53R2, a p53-inducible ribonucleotide reductase .
19667227 2009 Mitochondrial neurogastrointestinal encephalopathy due to mutations in RRM2B.
19664747 2009 A heterozygous truncating mutation in RRM2B causes autosomal-dominant progressive external ophthalmoplegia with multiple mtDNA deletions.
19138848 2009 A novel homozygous RRM2B missense mutation in association with severe mtDNA depletion.
19082948 2008 Redox property of ribonucleotide reductase small subunit M2 and p53R2.
18760875 2009 Regulation of p53R2 and its role as potential target for cancer therapy.
18505925 2008 Impairment of the DNA repair and growth arrest pathways by p53R2 silencing enhances DNA damage-induced apoptosis in a p53-dependent manner in prostate cancer cells.
18504129 2008 Mitochondrial DNA depletion syndrome due to mutations in the RRM2B gene.
18474260 2008 Upregulation of the p53R2 ribonucleotide reductase subunit by nitric oxide.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17671702 2007 Improvement in radiosensitivity using small interfering RNA targeting p53R2 in esophageal squamous cell carcinoma.
17486094 2007 Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion.
16872707 2006 Effect of high-risk human papillomavirus oncoproteins on p53R2 gene expression after DNA damage.
16846634 2006 Enzymatic property analysis of p53R2 subunit of human ribonucleotide reductase.
16778101 2006 Expression of p53R2 is related to prognosis in patients with esophageal squamous cell carcinoma.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16407418 2006 Polymorphisms in DNA repair genes modulate survival in cisplatin/gemcitabine-treated non-small-cell lung cancer patients.
16376858 2006 Characterization of enzymatic properties of human ribonucleotide reductase holoenzyme reconstituted in vitro from hRRM1, hRRM2, and p53R2 subunits.
16236544 2005 Genotoxicity test system based on p53R2 gene expression in human cells: examination with 80 chemicals.
16127747 2005 Novel genetic variations of the p53R2 gene in patients with colorectal adenoma and controls.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729598 2004 In vitro characterization of enzymatic properties and inhibition of the p53R2 subunit of human ribonucleotide reductase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583450 2003 The human ribonucleotide reductase subunit hRRM2 complements p53R2 in response to UV-induced DNA repair in cells with mutant p53.
12615712 2003 Wild-type p53 regulates human ribonucleotide reductase by protein-protein interaction with p53R2 as well as hRRM2 subunits.
12565178 2003 Expression of p53R2, newly p53 target in oral normal epithelium, epithelial dysplasia and squamous cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719458 2001 p53R2-dependent pathway for DNA synthesis in a p53-regulated cell cycle checkpoint.
11517226 2001 Mammalian p53R2 protein forms an active ribonucleotide reductase in vitro with the R1 protein, which is expressed both in resting cells in response to DNA damage and in proliferating cells.
10980602 2000 A ribonucleotide reductase gene is a transcriptional target of p53 and p73.
10716435 2000 A ribonucleotide reductase gene involved in a p53-dependent cell-cycle checkpoint for DNA damage.