Property Summary

NCBI Gene PubMed Count 36
PubMed Score 39.55
PubTator Score 25.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ovarian cancer -1.900 5.2e-07
chronic lymphocytic leukemia 1.408 1.8e-02
malignant mesothelioma -1.100 4.4e-06
invasive ductal carcinoma -2.100 7.7e-03
spina bifida -2.187 4.5e-02
Breast cancer -1.200 2.1e-03
ulcerative colitis -1.500 1.6e-04

Gene RIF (11)

PMID Text
24826867 R-Ras2 has a role in both primary breast tumorigenesis and the late metastatic steps of cancer cells in the lung parenchyma.
24148564 R-RAS2 is overexpressed in the early stages of malignancy in tumors of the human central nervous system.
21781067 This article is the first study demonstrating expression of TC21 in human skin malignant tumors and suggests that TC21 is more expressed in highly aggressive skin tumors.
21085126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20811707 Suggest that TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma and is associated with tumor progression and poor prognosis in HCC.
19692568 RasGRF GEFs can activate TC21 in all sublocalizations except the Golgi complex. Farnesylated TC21 can be activated by RasGRF1 & RasGRF2, but geranylgeranylated TC21 is unresponsive to RasGRF2.
19561613 TC21 directly links antigen receptors to PI(3)K-mediated survival pathways.
19460752 Knockdown of related RAS viral (r-ras) oncogene homolog 2 (RRAS2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19047159 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17656362 TGF-beta and TC21 have roles in tumorigenesis

AA Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA      1 - 70
GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE     71 - 140
EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF          141 - 204
//

Text Mined References (46)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
24826867 2014 Contribution of the R-Ras2 GTP-binding protein to primary breast tumorigenesis and late-stage metastatic disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24148564 2013 R-RAS2 overexpression in tumors of the human central nervous system.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21781067 2011 Greater expression of TC21/R-ras2 in highly aggressive malignant skin cancer.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21085126 2011 SNPs in axon guidance pathway genes and susceptibility for Parkinson's disease in the Korean population.
20811707 2010 TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19692568 2009 Structural and spatial determinants regulating TC21 activation by RasGRF family nucleotide exchange factors.
19561613 2009 Essential function for the GTPase TC21 in homeostatic antigen receptor signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19047159 2008 A polymorphism in the TC21 promoter associates with an unfavorable tamoxifen treatment outcome in breast cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
17656362 2007 Signaling pathways regulating TC21-induced tumorigenesis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15308774 2004 A tagging-via-substrate technology for detection and proteomics of farnesylated proteins.
15031288 2004 Identification and characterization of rain, a novel Ras-interacting protein with a unique subcellular localization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384139 2002 Ras and relatives--job sharing and networking keep an old family together.
11857081 2002 The putative tumor suppressor RASSF1A homodimerizes and heterodimerizes with the Ras-GTP binding protein Nore1.
11850823 2002 TC21 mediates transformation and cell survival via activation of phosphatidylinositol 3-kinase/Akt and NF-kappaB signaling pathway.
11788587 2002 Involvement of phosphatidylinositol 3-kinase, but not RalGDS, in TC21/R-Ras2-mediated transformation.
11335720 2001 Prenylated Rab acceptor protein is a receptor for prenylated small GTPases.
10777492 2000 Regulatory proteins of R-Ras, TC21/R-Ras2, and M-Ras/R-Ras3.
10557073 1999 Signal transduction elements of TC21, an oncogenic member of the R-Ras subfamily of GTP-binding proteins.
10498616 1999 M-Ras, a widely expressed 29-kD homologue of p21 Ras: expression of a constitutively active mutant results in factor-independent growth of an interleukin-3-dependent cell line.
10224125 1999 Thermodynamic and kinetic characterization of the interaction between the Ras binding domain of AF6 and members of the Ras subfamily.
10064593 1999 Activation of the Raf/MAP kinase cascade by the Ras-related protein TC21 is required for the TC21-mediated transformation of NIH 3T3 cells.
8052619 1994 A human oncogene of the RAS superfamily unmasked by expression cDNA cloning.
2108320 1990 Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line.