Property Summary

NCBI Gene PubMed Count 54
PubMed Score 144.32
PubTator Score 34.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
glioblastoma 1.300 1.2e-02
tuberculosis 2.800 2.2e-09
primary pancreatic ductal adenocarcinoma 1.607 9.7e-03
non-small cell lung cancer -1.515 1.1e-17
active ulcerative colitis 1.003 3.6e-02
pancreatic cancer 1.400 1.5e-02
breast carcinoma -1.100 6.7e-04
fibroadenoma -1.400 2.0e-02
lung adenocarcinoma -1.500 2.3e-17
pediatric high grade glioma 1.200 1.4e-03
lung carcinoma -2.200 1.5e-23
ductal carcinoma in situ -1.500 9.3e-04
invasive ductal carcinoma -1.300 1.1e-02
ovarian cancer -2.100 4.5e-10

Protein-protein Interaction (9)

Gene RIF (27)

PMID Text
27029009 Suggest that R-Ras regulates angiogenic activities of endothelial cells in part via inhibition of the p38MAPK-HSP27 axis of VEGF signaling.
26381333 RRAS is a key regulator of miR-34/449 promotion of actin network formation during multiciliogenesis.
25869066 Girdin regulates the trafficking of VE-cadherin in synergy with R-Ras.
25447204 phosphorylation of ORP3 controls its association with VAPA. Furthermore, ORP3-VAPA complexes stimulate R-Ras signaling.
25192052 Patients with gemistocytic astrocytomas with an RRAS deletion tend to have shorter survival rates than those without deletion.
24705357 Evidence is provided of a functional link between RRAS and MAPK signalling and reveal an unpredicted role of enhanced RRAS function in human disease.
24700169 Contradicting the positive association reported in previous studies, our results indicate that R-Ras activation may negatively regulate the transformation of breast epithelial cells.
24131527 A polymorphism linked to RRAS, SCAF1, IRF3 and BCL2L12 genes is associated with cirrhosis in hepatitis C virus carriers.
23209424 These data suggest that pharmacological inhibition of RRAS signaling may confer therapeutic benefit in Huntington's disease.
22897853 These findings identify R-Ras as a critical regulator of vessel integrity and function during tumor vascularization.
21660952 Maintaining endothelial barrier function is dependent upon active R-Ras and association between R-Ras and FLNa.
21390152 Data suggest that the RRAS gene is an important regulatory module in the pathogenesis of biliary atresia (BA), which may serve as a novel prognostic marker for BA.
20585650 data support a model in which R-Ras functionally associates with FLNa and thereby regulates integrin-dependent migration
20385769 Sema3E acts on plexin D1 to initiate a two-pronged mechanism involving R-Ras inactivation and Arf6 stimulation, which affect the status of activation of integrins and their intracellular trafficking, respectively.
19843518 the monomeric intracellular plexin-B1 binds R-Ras but not H-Ras. These findings suggest that the monomeric form of the intracellular region is primed for GAP activity and extend a model for plexin activation.
19116136 TCF8 activates R-Ras, another class of angiogenic regulator, to suppress angiogenesis by a mechanism other than a transcriptional attenuator.
19011236 results map the functional elements in the R-ras promoter sequence and suggest that the GABP may be critical for transcription of R-ras and for maintenance of normal blood vessel functions through the regulation of this gene
17664272 Notch1 ligand, Delta-like ligand-4, stimulates R-Ras-dependent alpha 5 beta 1 integrin-mediated adhesion, demonstrating the physiological relevance of this pathway.
17107957 R-Ras and ILK have roles upstream of GSK-3beta in the regulation of neuronal polarity
16914723 These findings show that R-Ras activity mediates inhibition of insulin signaling associated with suppression of estrogen action, implicating this GTPase in a growth-inhibitory mechanism associated with antiestrogen treatment of breast cancer.
16754664 GPCRs rapidly activate R-Ras; R-Ras activation by the GPCRs is apparently directly induced by cyclic AMP-regulated Epac proteins; and activated R-Ras specifically controls GPCR-mediated phospholipase D stimulation
15525681 R-Ras plays a key role in cell migration by locally regulating the switch from Rac to Rho activity after membrane protrusion and adhesion
15297673 Plexin-B1 mediates Sema4D-induced repulsive axon guidance signaling by acting as a GTPase activating protein for R-Ras
12890755 activation of R-Ras promotes the formation of focal adhesions and a spread cell shape
12548599 the oncogene R-Ras promotes tumor growth of cervical epithelial cells and increases their migration potential over collagen through a pathway that involves PI 3-K.
12529399 R-Ras promotes focal adhesion formation by signaling to FAK and p130(Cas) through a novel mechanism that differs from but synergizes with the alpha2beta1 integrin.
12386818 study of the potential contribution in generating of estrogen-independence in MCF-7 cells

AA Sequence

MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC      1 - 70
SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV     71 - 140
GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG    141 - 210
GGCPCVLL                                                                  211 - 218
//

Text Mined References (57)

PMID Year Title
27029009 2015 R-Ras Inhibits VEGF-Induced p38MAPK Activation and HSP27 Phosphorylation in Endothelial Cells.
26381333 2015 miR-34/449 control apical actin network formation during multiciliogenesis through small GTPase pathways.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25869066 2015 Girdin/GIV regulates transendothelial permeability by controlling VE-cadherin trafficking through the small GTPase, R-Ras.
25447204 2015 OSBP-related protein 3 (ORP3) coupling with VAMP-associated protein A regulates R-Ras activity.
25192052 2014 Alterations of the RRAS and ERCC1 genes at 19q13 in gemistocytic astrocytomas.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24705357 2014 Activating mutations in RRAS underlie a phenotype within the RASopathy spectrum and contribute to leukaemogenesis.
24700169 2014 Negative association of R-Ras activation and breast cancer development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24131527 2014 A polymorphism linked to RRAS, SCAF1, IRF3 and BCL2L12 genes is associated with cirrhosis in hepatitis C virus carriers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209424 2012 A genome-scale RNA-interference screen identifies RRAS signaling as a pathologic feature of Huntington's disease.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
22897853 2012 Small GTPase R-Ras regulates integrity and functionality of tumor blood vessels.
21660952 2011 R-Ras interacts with filamin a to maintain endothelial barrier function.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21393242 2011 A phosphodiesterase 3B-based signaling complex integrates exchange protein activated by cAMP 1 and phosphatidylinositol 3-kinase signals in human arterial endothelial cells.
21390152 2011 RRAS: A key regulator and an important prognostic biomarker in biliary atresia.
20585650 2010 R-Ras regulates migration through an interaction with filamin A in melanoma cells.
20385769 2010 Semaphorin 3E initiates antiangiogenic signaling through plexin D1 by regulating Arf6 and R-Ras.
19843518 2009 Structure and function of the intracellular region of the plexin-b1 transmembrane receptor.
19116136 2009 Transcription factor 8 activates R-Ras to regulate angiogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19011236 2009 Promoter cloning and characterization of the anti-vascular proliferation gene, R-ras: role of Ets- and Sp-binding motifs.
18270267 2008 The R-Ras interaction partner ORP3 regulates cell adhesion.
17664272 2007 Mammalian NOTCH-1 activates beta1 integrins via the small GTPase R-Ras.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17107957 2007 R-Ras controls axon specification upstream of glycogen synthase kinase-3beta through integrin-linked kinase.
16914723 2006 The R-Ras GTPase mediates cross talk between estrogen and insulin signaling in breast cancer cells.
16773572 2006 Germline missense mutations affecting KRAS Isoform B are associated with a severe Noonan syndrome phenotype.
16754664 2006 Cyclic AMP-dependent and Epac-mediated activation of R-Ras by G protein-coupled receptors leads to phospholipase D stimulation.
16537651 2006 The small GTPase R-Ras regulates organization of actin and drives membrane protrusions through the activity of PLCepsilon.
15525681 2005 R-Ras controls membrane protrusion and cell migration through the spatial regulation of Rac and Rho.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297673 2004 The Semaphorin 4D receptor Plexin-B1 is a GTPase activating protein for R-Ras.
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15031288 2004 Identification and characterization of rain, a novel Ras-interacting protein with a unique subcellular localization.
12890755 2003 The C-terminal end of R-Ras contains a focal adhesion targeting signal.
12548599 2003 R-Ras promotes tumor growth of cervical epithelial cells.
12529399 2003 R-Ras promotes focal adhesion formation through focal adhesion kinase and p130(Cas) by a novel mechanism that differs from integrins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386818 2002 Involvement of R-Ras and Ral GTPases in estrogen-independent proliferation of breast cancer cells.
11857081 2002 The putative tumor suppressor RASSF1A homodimerizes and heterodimerizes with the Ras-GTP binding protein Nore1.
11560935 2001 Basis for signaling specificity difference between Sos and Ras-GRF guanine nucleotide exchange factors.
11042683 2000 The effector loop and prenylation site of R-Ras are involved in the regulation of integrin function.
10848612 2000 Isoform-specific localization of A-RAF in mitochondria.
10777492 2000 Regulatory proteins of R-Ras, TC21/R-Ras2, and M-Ras/R-Ras3.
10713701 2000 Positive regulation of skeletal myogenesis by R-Ras.
10671570 2000 R-Ras contains a proline-rich site that binds to SH3 domains and is required for integrin activation by R-Ras.
10570155 1999 An Eph receptor regulates integrin activity through R-Ras.
10412982 1999 Endomembrane trafficking of ras: the CAAX motif targets proteins to the ER and Golgi.
10224125 1999 Thermodynamic and kinetic characterization of the interaction between the Ras binding domain of AF6 and members of the Ras subfamily.
8232588 1993 Bcl-2 associates with the ras-related protein R-ras p23.
7809086 1994 Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap.
7761092 1995 Farnesyltransferase inhibitors are inhibitors of Ras but not R-Ras2/TC21, transformation.
3098437 1987 Structure of the human and murine R-ras genes, novel genes closely related to ras proto-oncogenes.