Property Summary

NCBI Gene PubMed Count 22
PubMed Score 26.23
PubTator Score 8.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 1.3e-02
ependymoma -1.500 4.2e-02
glioblastoma -1.100 7.0e-03
malignant mesothelioma -1.400 6.8e-06
medulloblastoma, large-cell -1.100 2.5e-02
oligodendroglioma -1.500 1.9e-02
psoriasis -1.300 1.3e-03

Gene RIF (3)

AA Sequence

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR      1 - 70
RLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRD     71 - 140
NIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLR    141 - 210
RLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQC    211 - 280
KEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLIN    281 - 350
IRNARKHFEKLERVDGPKQCLLMR                                                  351 - 374
//

Text Mined References (27)

PMID Year Title