Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.600 3.8e-04
astrocytic glioma -1.500 3.3e-02
atypical teratoid / rhabdoid tumor -1.200 2.9e-03
ependymoma -1.100 3.2e-02
glioblastoma -1.200 9.8e-03
group 4 medulloblastoma -1.200 5.4e-04
osteosarcoma -1.795 2.9e-03
ovarian cancer -1.200 3.7e-04

AA Sequence

MRAVLAREMDGRRVLGRFWSGWRRGLGVRPVPEDAGFGTEARHQRQPRGSCQRSGPLGDQPFAGLLPKNL      1 - 70
SREELVDALRAAVVDRKGPLVTLNKPQGLPVTGKPGELTLFSVLPELSQSLGLREQELQVVRASGKESSG     71 - 140
LVLLSSCPQTASRLQKYFTHARRAQRPTATYCAVTDGIPAASEGKIQAALKLEHIDGVNLTVPVKAPSRK    141 - 210
DILEGVKKTLSHFRVVATGSGCALVQLQPLTVFSSQLQVHMVLQLCPVLGDHMYSARVGTVLGQRFLLPA    211 - 280
ENNKPQRQVLDEALLRRLHLTPSQAAQLPLHLHLHRLLLPGTRARDTPVELLAPLPPYFSRTLQCLGLRL    281 - 350
Q//

Text Mined References (14)

PMID Year Title