Property Summary

NCBI Gene PubMed Count 91
PubMed Score 554.83
PubTator Score 117.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.4e-02

Protein-protein Interaction (3)

Gene RIF (49)

PMID Text
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26363527 the expressions of Beclin1, Raptor, and Rictor are related to the development and progression of colorectal carcinoma and multidrug resistance.
25849663 microRNA-210 and raptor are involved in mithramycin-mediated erythroid differentiation of K562 cells and participate to the fine-tuning and control of gamma-globin gene expression in erythroid precursor cells.
25533680 Studied the impact of SNPs in/near UCP3 and RPTOR on obesity-related traits.
25249372 Common genetic variation in RPTOR is associated with overweight/obesity but does not discernibly contribute to either essential hypertension or isolated systolic hypertension in the Hawaiian population studied.
25053281 RPTOR was not associated with bipolar disorder or schizophrenia.
24516643 phosphorylating the T-loop Akt residue Thr(308) by PDK1 requires Raptor of the mTORC1 complex as a platform or scaffold protein.
24403073 peptides that encompass the Raptor cross-linking region of 4E-BP1 inhibit cross-linking and interaction of 4E-BP1 with Raptor.
24337580 Amino acids promote mTORC1 activation without altering Rag GTP charging.
24005976 suggest no connection of RPTOR variants with psoriasis or its subphenotypes.
23898069 Histolopathological and clinical information including tumour stage, invasion characteristic and endocrine status were analysed against the gene transcript expression of mTOR, RAPTOR and RICTOR.
23563607 Single nucleotide polymorphisms in RPTOR gene is associated with obesity.
23541542 There is a significant downregulation of mTOR, DEPTOR, and Raptor in preterm labouring myometria when compared to non-pregnant tissues taken from the same area.
23423739 Raptor polymorphism is associated with gastric cancer.
22493283 found that osmotic stress activates mTORC1 kinase activity in a JNK-dependent manner. Our findings suggest that the molecular link between JNK and Raptor is a potential mechanism by which stress regulates the mTORC1 signaling pathway
22356909 an important role for ICK in modulating the activity of mTORC1 through phosphorylation of Raptor Thr-908.
22258093 An essential role of mTORC1 in autophagy inhibition in cell-free system in which, membrane association of Barkor/Atg14(L), a specific autophagosome-binding protein, is suppressed by cytosol from nutrient-rich medium, is shown.
21900751 Phosphorylated forms of Raptor are significantly increased in mitotic cells. Raptor resides at the nucleoplasm and nucleolus of interphase cells and remains targeted to nucleolar organizer regions during mitosis.
21613227 a previously unrecognized function of miR-21 that is the reciprocal regulation of PTEN levels and Akt/TORC1 activity that mediate critical pathologic features of diabetic kidney disease
21460630 ULK1 contributes to mTORC1 inhibition through hindrance of substrate docking to Raptor.
21454807 Adiponectin induces vascular smooth muscle cell differentiation via repression of mammalian target of rapamycin complex 1 and FoxO4
21325048 The study identified raptor as a substrate for p44/42 MAPK.
21321085 results suggest that GRp58/ERp57 is involved in the assembly of mTORC1 and positively regulates mTORC1 signaling at the cytosol and the cytosolic side of the endoplasmic reticulum
21283628 show that E2F1 is capable of inducing growth by regulating mTORC1 activity
21071439 a novel regulatory mechanism by which mitogenic and oncogenic activation of the Ras/MAPK pathway promotes mTOR signaling
21060808 Data show that a SNP (rs11868112) 26 kb upstream to the transcription start site of RPTOR exhibiting the strongest association with temperature variables.
20439490 These data suggest that the raptor/mTORC1 pathway may play a role in increased IRES-dependent mRNA translation during mitosis and in rapamycin insensitivity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20354165 Observational study of gene-disease association. (HuGE Navigator)
20169205 Study demonstrates that Serine 696 and Threonine 706 represent two key sites in raptor phosphorylation during mitosis, and that the mitotic cyclin-dependent kinase cdc2/CDK1 is the kinase responsible for phosphorylating these sites.
19921495 Observational study of gene-disease association. (HuGE Navigator)
19864431 Complex raptor phosphorylation functions as a biochemical rheostat that modulates mTORC1 signaling in accordance with environmental cues.
19724909 Report involvement of mTORC1 and mTORC2 in regulation of glioblastoma multiforme growth and motility.
19561084 It has been shown that knockdown of Raptor suppresses insulin-stimulated phosphorylation of IRS-1 at Ser-636/639 and stabilizes IRS-1 after long term insulin stimulation.
19145465 S2448 phosphorylated mTOR binds to both raptor and rictor.
19139211 no evidence was found for association of SNPs mapping to the NAT9, SLC9A3R1 and RAPTOR loci with susceptibility to psoriatic arthritis
18776922 there are two parallel cell-survival pathways in prostate cancer cells: a strong Akt-independent, but rapamycin-sensitive pathway downstream of mTORC1, and an AR-dependent pathway downstream of mTORC2 and Akt, that is stimulated by mTORC1 inhibition
18722121 RSK-mediated phosphorylation of Raptor regulates mTORC1 activity.
18497260 Rag GTPases bind raptor and are necessary and sufficient to mediate amino acid signaling to mTORC1
18439900 The phosphorylation of raptor by AMPK is required for the inhibition of mTORC1 and cell-cycle arrest induced by energy stress.
17656678 Proarteriosclerotic effects of interferon gamma are associated with mammalian target of rapamycin raptor complex (mTORC1) and PI-3 kinase activiation.
17329400 ASCT2 silencing inhibits mTORC1 (mTOR/raptor) signaling and leads to growth repression, followed by enhanced survival signaling via mTORC2 (mTOR/rictor) and apoptosis of hepatoma cells.
16959881 These data suggest that, during HCMV infection, the rictor- and raptor-containing complexes are modified such that their substrate specificities and rapamycin sensitivities are altered.
16914728 These studies suggest that, through serine phosphorylation, Raptor-mTOR and S6K1 promote the depletion of IRS1 from specific intracellular pools in pathological states of insulin and IGF-I resistance and in lesions associated with tuberous sclerosis.
16354680 Raptor directly binds to and serves as a scaffold for mTOR-mediated phosphorylation of IRS-1 on Ser636/639.
16183647 A redox-sensitive mechanism regulates the phosphorylation of the raptor-mTOR effector S6K1, the interaction between raptor and mTOR, and the kinase activity of the raptor-mTOR complex.
12604610 raptor binds to p70S6k and 4E-BP1 through their respective TOS (conserved TOR signaling) motifs.
12150926 raptor is an essential scaffold for the mTOR-catalyzed phosphorylation of 4EBP1 and mediates TOR action in vivo.
12150925 Raptor is a missing component of the mTOR pathway that through its association with mTOR regulates cell size in response to nutrient levels

AA Sequence

MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGV      1 - 70
DPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRN     71 - 140
AKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFA    141 - 210
LQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCM    211 - 280
QKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNF    281 - 350
LLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL    351 - 420
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPL    421 - 490
LVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIA    491 - 560
ICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNS    561 - 630
AERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATT    631 - 700
EGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLG    701 - 770
SPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK    771 - 840
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTG    841 - 910
PAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDL    911 - 980
ESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWD    981 - 1050
WEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLP   1051 - 1120
TTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSI   1121 - 1190
RVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD   1191 - 1260
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV   1261 - 1330
EKRVR                                                                    1331 - 1335
//

Text Mined References (105)

PMID Year Title
26787466 2016 The PtdIns3-phosphatase MTMR3 interacts with mTORC1 and suppresses its activity.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26363527 2015 Autophagy-related genes Raptor, Rictor, and Beclin1 expression and relationship with multidrug resistance in colorectal carcinoma.
25849663 2015 Increase of microRNA-210, decrease of raptor gene expression and alteration of mammalian target of rapamycin regulated proteins following mithramycin treatment of human erythroid cells.
25657994 The Potential Role of BRCA1-Associated ATM Activator-1 (BRAT1) in Regulation of mTOR.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25533680 2014 Seasonal effects of the UCP3 and the RPTOR gene polymorphisms on obesity traits in Japanese adults.
25446900 2014 Rab1A is an mTORC1 activator and a colorectal oncogene.
25249372 2015 Genetic variation in the raptor gene is associated with overweight but not hypertension in American men of Japanese ancestry.
25053281 2015 Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder.
24516643 2014 Activated ?2-macroglobulin binding to cell surface GRP78 induces T-loop phosphorylation of Akt1 by PDK1 in association with Raptor.
24403073 2014 Characterization of the Raptor/4E-BP1 interaction by chemical cross-linking coupled with mass spectrometry analysis.
24375676 2014 mTORC2 phosphorylates protein kinase C? to regulate its stability and activity.
24337580 2014 Amino acids activate mammalian target of rapamycin (mTOR) complex 1 without changing Rag GTPase guanyl nucleotide charging.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036451 2013 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
24005976 2014 Common variants of ZNF750, RPTOR and TRAF3IP2 genes and psoriasis risk.
23953116 2013 Inhibition of mTORC1 by astrin and stress granules prevents apoptosis in cancer cells.
23898069 2013 Expression of the mTOR pathway regulators in human pituitary adenomas indicates the clinical course.
23727834 2013 The Bardet-Biedl syndrome-related protein CCDC28B modulates mTORC2 function and interacts with SIN1 to control cilia length independently of the mTOR complex.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23541542 2014 The human myometrium differentially expresses mTOR signalling components before and during pregnancy: evidence for regulation by progesterone.
23423739 2013 Genetic variations of mTORC1 genes and risk of gastric cancer in an Eastern Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
23027611 2012 5-HT(6) receptor recruitment of mTOR as a mechanism for perturbed cognition in schizophrenia.
22493283 2012 Osmotic stress regulates mammalian target of rapamycin (mTOR) complex 1 via c-Jun N-terminal Kinase (JNK)-mediated Raptor protein phosphorylation.
22424946 2012 Leucyl-tRNA synthetase is an intracellular leucine sensor for the mTORC1-signaling pathway.
22356909 2012 Intestinal cell kinase (ICK) promotes activation of mTOR complex 1 (mTORC1) through phosphorylation of Raptor Thr-908.
22258093 2012 Reconstitution of leucine-mediated autophagy via the mTORC1-Barkor pathway in vitro.
21900751 2011 Raptor, a positive regulatory subunit of mTOR complex 1, is a novel phosphoprotein of the rDNA transcription machinery in nucleoli and chromosomal nucleolus organizer regions (NORs).
21613227 2011 MicroRNA-21 orchestrates high glucose-induced signals to TOR complex 1, resulting in renal cell pathology in diabetes.
21471201 2011 Cancer cell survival following DNA damage-mediated premature senescence is regulated by mammalian target of rapamycin (mTOR)-dependent Inhibition of sirtuin 1.
21460630 2011 ULK1 inhibits mTORC1 signaling, promotes multisite Raptor phosphorylation and hinders substrate binding.
21454807 2011 Adiponectin induces vascular smooth muscle cell differentiation via repression of mammalian target of rapamycin complex 1 and FoxO4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21339740 2011 Selective activation of Akt1 by mammalian target of rapamycin complex 2 regulates cancer cell migration, invasion, and metastasis.
21325048 2011 The identification of raptor as a substrate for p44/42 MAPK.
21321085 2011 Regulation of mTORC1 complex assembly and signaling by GRp58/ERp57.
21283628 2011 E2F1 regulates cellular growth by mTORC1 signaling.
21269460 2011 Initial characterization of the human central proteome.
21071439 2011 ERK1/2 phosphorylate Raptor to promote Ras-dependent activation of mTOR complex 1 (mTORC1).
21060808 2010 Allele-specific down-regulation of RPTOR expression induced by retinoids contributes to climate adaptations.
21045808 2010 mTORC2 can associate with ribosomes to promote cotranslational phosphorylation and stability of nascent Akt polypeptide.
20562859 2010 Network organization of the human autophagy system.
20543138 2010 mTOR associates with TFIIIC, is found at tRNA and 5S rRNA genes, and targets their repressor Maf1.
20439490 2010 Mitotic raptor promotes mTORC1 activity, G(2)/M cell cycle progression, and internal ribosome entry site-mediated mRNA translation.
20381137 2010 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20354165 2010 Energy balance, the PI3K-AKT-mTOR pathway genes, and the risk of bladder cancer.
20347422 2010 Postnatal deamidation of 4E-BP2 in brain enhances its association with raptor and alters kinetics of excitatory synaptic transmission.
20233713 2010 Requirement of the mTOR kinase for the regulation of Maf1 phosphorylation and control of RNA polymerase III-dependent transcription in cancer cells.
20169205 2010 Raptor is phosphorylated by cdc2 during mitosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19921495 2010 A rare Asian founder polymorphism of Raptor may explain the high prevalence of Moyamoya disease among East Asians and its low prevalence among Caucasians.
19875983 2009 The target of rapamycin complex 2 controls dendritic tiling of Drosophila sensory neurons through the Tricornered kinase signalling pathway.
19864431 2010 Regulation of mTOR complex 1 (mTORC1) by raptor Ser863 and multisite phosphorylation.
19724909 2009 Involvement of mTORC1 and mTORC2 in regulation of glioblastoma multiforme growth and motility.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19619545 2009 Ribavirin enhances interferon signaling via stimulation of mTOR and p53 activities.
19561084 2009 Raptor binds the SAIN (Shc and IRS-1 NPXY binding) domain of insulin receptor substrate-1 (IRS-1) and regulates the phosphorylation of IRS-1 at Ser-636/639 by mTOR.
19446321 2009 DEPTOR is an mTOR inhibitor frequently overexpressed in multiple myeloma cells and required for their survival.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19388141 2009 Characterization of a novel splicing variant in the RAPTOR gene.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19211835 2009 Nutrient-dependent mTORC1 association with the ULK1-Atg13-FIP200 complex required for autophagy.
19145465 2010 mTOR phosphorylated at S2448 binds to raptor and rictor.
19139211 2009 Investigation of association of genes NAT9, SLC9A3R1 and RAPTOR on chromosome 17q25 with psoriatic arthritis.
18776922 2008 Regulation of androgen receptor transcriptional activity by rapamycin in prostate cancer cell proliferation and survival.
18722121 2008 Oncogenic MAPK signaling stimulates mTORC1 activity by promoting RSK-mediated raptor phosphorylation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18497260 2008 The Rag GTPases bind raptor and mediate amino acid signaling to mTORC1.
18439900 2008 AMPK phosphorylation of raptor mediates a metabolic checkpoint.
18426977 2008 eIF4GI links nutrient sensing by mTOR to cell proliferation and inhibition of autophagy.
18337751 2008 cdc2-cyclin B regulates eEF2 kinase activity in a cell cycle- and amino acid-dependent manner.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17897319 2007 Integral and associated lysosomal membrane proteins.
17656678 2007 Interferon-gamma induces human vascular smooth muscle cell proliferation and intimal expansion by phosphatidylinositol 3-kinase dependent mammalian target of rapamycin raptor complex 1 activation.
17565979 2007 P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration.
17461779 2007 Identification of Protor as a novel Rictor-binding component of mTOR complex-2.
17386266 2007 PRAS40 is an insulin-regulated inhibitor of the mTORC1 protein kinase.
17329400 2007 ASCT2 silencing regulates mammalian target-of-rapamycin growth and survival signaling in human hepatoma cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959881 2006 Human cytomegalovirus infection alters the substrate specificities and rapamycin sensitivities of raptor- and rictor-containing complexes.
16914728 2006 Turnover of the active fraction of IRS1 involves raptor-mTOR- and S6K1-dependent serine phosphorylation in cell culture models of tuberous sclerosis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16354680 2006 Nutrients suppress phosphatidylinositol 3-kinase/Akt signaling via raptor-dependent mTOR-mediated insulin receptor substrate 1 phosphorylation.
16183647 2005 Redox regulation of the nutrient-sensitive raptor-mTOR pathway and complex.
15809305 2005 Structure of S6 kinase 1 determines whether raptor-mTOR or rictor-mTOR phosphorylates its hydrophobic motif site.
15755954 2005 Signaling by target of rapamycin proteins in cell growth control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467718 2004 Mammalian TOR complex 2 controls the actin cytoskeleton and is rapamycin insensitive.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15066126 2004 Dissociation of raptor from mTOR is a mechanism of rapamycin-induced inhibition of mTOR function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12747827 2003 TOS motif-mediated raptor binding regulates 4E-BP1 multisite phosphorylation and function.
12718876 2003 GbetaL, a positive regulator of the rapamycin-sensitive pathway required for the nutrient-sensitive interaction between raptor and mTOR.
12604610 2003 The mammalian target of rapamycin (mTOR) partner, raptor, binds the mTOR substrates p70 S6 kinase and 4E-BP1 through their TOR signaling (TOS) motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408816 2002 Two TOR complexes, only one of which is rapamycin sensitive, have distinct roles in cell growth control.
12150926 2002 Raptor, a binding partner of target of rapamycin (TOR), mediates TOR action.
12150925 2002 mTOR interacts with raptor to form a nutrient-sensitive complex that signals to the cell growth machinery.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.